ZNF320 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86473

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF320 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human ZNF320. Peptide sequence: NDHEAPMTEIKKLTSSTDRYDQRHAGNKPIKGQLESRFHLHLRRHRRIHT The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF320 Antibody - BSA Free

Western Blot: ZNF320 Antibody [NBP2-86473]

Western Blot: ZNF320 Antibody [NBP2-86473]

Western Blot: ZNF320 Antibody [NBP2-86473] - WB Suggested Anti-ZNF320 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: MCF7 cell lysate
Western Blot: ZNF320 Antibody [NBP2-86473]

Western Blot: ZNF320 Antibody [NBP2-86473]

Western Blot: ZNF320 Antibody [NBP2-86473] - Host: Rabbit. Target: ZNF320. Positive control (+): Human Lung (LU). Negative control (-): Human Liver (LI). Antibody concentration: 1ug/ml

Applications for ZNF320 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF320

ZNF320 encodes a Kruppel-like zinc finger protein. Members of this protein family are involved in activation orrepression of transcription.(supplied by OMIM)

Alternate Names

DKFZp686G16228, ZFPL, zinc finger gene 320, zinc finger protein 320, zinc finger protein like

Gene Symbol

ZNF320

Additional ZNF320 Products

Product Documents for ZNF320 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF320 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF320 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF320 Antibody - BSA Free and earn rewards!

Have you used ZNF320 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies