ZNF323 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-88664

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF323 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF323. Peptide sequence: QEILKEMEHLGDSKLQRDVSLDSKYRETCKRDSKAEKQQAHSTGERRHRC The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZNF323 Antibody - BSA Free

Western Blot: ZNF323 Antibody [NBP2-88664]

Western Blot: ZNF323 Antibody [NBP2-88664]

Western Blot: ZNF323 Antibody [NBP2-88664] - WB Suggested Anti-ZNF323 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:1562500. Positive Control: Jurkat cell lysate

Applications for ZNF323 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF323

"ZNF323 may function as a transcription factor. May be involved in the development of multiple embryonic organs.

Alternate Names

dJ874C20.2, DKFZp434K1210, HDBP-2, HDBP2HDRF-2, Huntington disease gene regulatory region-binding protein 2, Huntington's disease gene regulatory region-binding protein 2, Papillomavirus regulatory factor 1, papillomavirus regulatory factor PRF-1, Papillomavirus-binding factor, PBFHD gene regulatory region-binding protein 2, PRF1, PRF-1HD-regulating factor 2, Si-1-8-14, zinc finger protein 395, ZNF20-Lp, ZNF310P

Gene Symbol

ZSCAN31

Additional ZNF323 Products

Product Documents for ZNF323 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF323 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF323 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF323 Antibody - BSA Free and earn rewards!

Have you used ZNF323 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies