ZNF331 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-55808

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZNF331 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENSF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF331 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ZNF331 Antibody [NBP2-55808]

Immunocytochemistry/ Immunofluorescence: ZNF331 Antibody [NBP2-55808]

Immunocytochemistry/Immunofluorescence: ZNF331 Antibody [NBP2-55808] - Staining of human cell line HEK 293 shows localization to nucleoplasm.
ZNF331 Antibody - BSA Free Chromatin Immunoprecipitation ChIP: ZNF331 Antibody - BSA Free

Chromatin Immunoprecipitation ChIP: ZNF331 Antibody - BSA Free

ChIP-Exo-Seq composite graph for Anti-ZNF331 tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh's Lab at Cornell University.

Applications for ZNF331 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml
Application Notes
ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF331

Zinc finger proteins have been shown to interact with nucleic acids and to have diverse functions. The zinc finger domain is a conserved amino acid sequence motif containing 2 specifically positioned cysteines and 2 histidines that are involved in coordinating zinc. Kruppel-related proteins form one family of zinc finger proteins. See ZFP93 (MIM 604749) for additional information on zinc finger proteins.[supplied by OMIM]

Alternate Names

ZFN533, zinc finger protein 385B, Zinc finger protein 533FLJ25270, ZNF533

Gene Symbol

ZNF331

Additional ZNF331 Products

Product Documents for ZNF331 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF331 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF331 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF331 Antibody - BSA Free and earn rewards!

Have you used ZNF331 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies