ZNF592 Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-11016

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
View all ZNF592 Primary Antibodies »

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF592 (NP_055445). Peptide sequence FSPISSPEPEDPIKDNGFGIKPKHSDSYFPPPLGCGAVGGPVLEALAKFP

Clonality

Polyclonal

Host

Rabbit

Theoretical MW

139 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ZNF592 Antibody - BSA Free

Western Blot: ZNF592 Antibody [NBP3-11016]

Western Blot: ZNF592 Antibody [NBP3-11016]

Western Blot: ZNF592 Antibody [NBP3-11016] - Western blot analysis of ZNF592 in Human 293T Whole Cell lysates. Antibody dilution at 2ug/ml

Applications for ZNF592 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNF592

ZNF592 is a zinc-finger protein that belongs to the krueppel C2H2-type zinc-finger family of proteins. ZNF592 bears 13 C2H2-type zinc-fingers and is hypothesized to function as a transcriptional regulator.

Alternate Names

CAMOS, KIAA0211MGC138437, MGC138439, SCAR5, spinocerebellar ataxia, autosomal recessive 5, zinc finger protein 592

Gene Symbol

ZNF592

Additional ZNF592 Products

Product Documents for ZNF592 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZNF592 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNF592 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNF592 Antibody - BSA Free and earn rewards!

Have you used ZNF592 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies