ZNF76 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-04364

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ZNF76 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 100-170 of human ZNF76 (NP_003418.2). HPVAVPSESTILAVQTEVGLEDLAAEDDEGFSADAVVALEQYASKVLHDSQIPRNGKGQQVGDRAFRCGYK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ZNF76 Antibody - Azide and BSA Free

Western Blot: ZNF76 AntibodyAzide and BSA Free [NBP3-04364]

Western Blot: ZNF76 AntibodyAzide and BSA Free [NBP3-04364]

Western Blot: ZNF76 Antibody [NBP3-04364] - Analysis of extracts of various cell lines, using ZNF76 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

Applications for ZNF76 Antibody - Azide and BSA Free

Application
Recommended Usage

Western Blot

1:500-1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ZNF76

ZNF76 may be involved in transcriptional regulation

Alternate Names

D6S229EZfp523, zinc finger protein 76, zinc finger protein 76 (expressed in testis), ZNF523Zinc finger protein 523

Gene Symbol

ZNF76

Additional ZNF76 Products

Product Documents for ZNF76 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNF76 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ZNF76 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ZNF76 Antibody - Azide and BSA Free and earn rewards!

Have you used ZNF76 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies