ZNRF1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80377

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ZNRF1 Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human ZNRF1. Peptide sequence MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRS. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ZNRF1 Antibody - BSA Free

Western Blot: ZNRF1 Antibody [NBP1-80377]

Western Blot: ZNRF1 Antibody [NBP1-80377]

Western Blot: ZNRF1 Antibody [NBP1-80377] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Applications for ZNRF1 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZNRF1

In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene. [provided by RefSeq]

Alternate Names

DKFZp434E229, EC 6.3.2, EC 6.3.2.-, FLJ14846, MGC15430, nerve injury gene 283, Nerve injury-induced gene 283 protein, nin283, NIN283E3 ubiquitin-protein ligase ZNRF1, zinc and ring finger 1, zinc and ring finger protein 1, Zinc/RING finger protein 1

Gene Symbol

ZNRF1

UniProt

NP_115644 (Human)

Additional ZNRF1 Products

Product Documents for ZNRF1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ZNRF1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZNRF1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZNRF1 Antibody - BSA Free and earn rewards!

Have you used ZNRF1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies