ZP3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-86566

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ZP3. Peptide sequence: NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVTVGATDLPGQEW The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for ZP3 Antibody - BSA Free

Western Blot: ZP3 Antibody [NBP2-86566]

Western Blot: ZP3 Antibody [NBP2-86566]

Western Blot: ZP3 Antibody [NBP2-86566] - WB Suggested Anti-ZP3 Antibody Titration: 0.6ug/ml. ELISA Titer: 1:62500. Positive Control: HepG2 cell lysate
Western Blot: ZP3 Antibody [NBP2-86566]

Western Blot: ZP3 Antibody [NBP2-86566]

Western Blot: ZP3 Antibody [NBP2-86566] - Host: Rabbit. Target: ZP3. Positive control (+): MCF7 Cell Lysate (N10). Negative control (-): Human Kidney (KI). Antibody concentration: 5ug/ml

Applications for ZP3 Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ZP3

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene. [provided by RefSeq]

Alternate Names

zona pellucida glycoprotein 3 (sperm receptor)

Gene Symbol

ZP3

Additional ZP3 Products

Product Documents for ZP3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ZP3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ZP3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ZP3 Antibody - BSA Free and earn rewards!

Have you used ZP3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...