60S ribosomal protein L23 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-87847

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ISLGLPVGAVINCADNTGAKNLYIISVKGIKGRLNRLPAAGVGDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for 60S ribosomal protein L23 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunocytochemistry/ Immunofluorescence: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunocytochemistry/Immunofluorescence: 60S ribosomal protein L23 Antibody [NBP1-87847] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847] - Staining of human kink shows weak to moderate cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847] - Staining of human breast shows strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847] - Staining of human pancreas shows strong cytoplasmic positivity in excorine glandular cells.
Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody [NBP1-87847] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal center cells.
60S ribosomal protein L23 Antibody - BSA Free Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody - BSA Free [NBP1-87847]

Immunohistochemistry-Paraffin: 60S ribosomal protein L23 Antibody - BSA Free [NBP1-87847]

Staining of human breast shows strong cytoplasmic positivity in glandular cells.
60S ribosomal protein L23 Antibody - BSA Free Western Blot: 60S ribosomal protein L23 Antibody - BSA Free [NBP1-87847]

Western Blot: 60S ribosomal protein L23 Antibody - BSA Free [NBP1-87847]

Analysis in human cell line THP-1.

Applications for 60S ribosomal protein L23 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: 60S ribosomal protein L23

RPL23 - ribosomal protein L23

Alternate Names

MGC111167, MGC117346, MGC72008,60S ribosomal protein L17,60S ribosomal protein L23, ribosomal protein L17, ribosomal protein L23, rpL17

Gene Symbol

RPL23

Additional 60S ribosomal protein L23 Products

Product Documents for 60S ribosomal protein L23 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for 60S ribosomal protein L23 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for 60S ribosomal protein L23 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review 60S ribosomal protein L23 Antibody - BSA Free and earn rewards!

Have you used 60S ribosomal protein L23 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...