Abhd5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84507

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (96%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MTIPYGWAKRPMLQRIGKMHPDIPVSVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQKVKEI

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Abhd5 Antibody - BSA Free

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507] - Staining of human testis shows moderate cytoplasmic positivity in a small subset of cells in seminiferous ducts.
Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507] - Staining of human Fallopian tube shows strong positivity in cilia in glandular cells.
Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507]

Immunohistochemistry-Paraffin: Abhd5 Antibody [NBP1-84507] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Abhd5 Antibody - BSA Free Western Blot: Abhd5 Antibody - BSA Free [NBP1-84507]

Western Blot: Abhd5 Antibody - BSA Free [NBP1-84507]

Analysis in control (vector only transfected HEK293T lysate) and ABHD5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY402485).

Applications for Abhd5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Abhd5

Abhydrolase domain containing 5 (ABHD5) belongs to a very large protein family which contains an alpha/beta hydrolase fold. ABHD5 also contains three sequence motifs that correspond to a catalytic triad found in the esterase/lipase/thioesterase subfamily. Abhd 5 is distinct from other members of this subfamily because the putative catalytic triad contains an asparagine rather than a serine residue.

ABHD5 is a lysophosphatidic acid acyltransferase with a role in phosphatidic acid biosynthesis. ABHD5 may also help regulate cellular storage of triacylglycerol by activating the phospholipase PNPLA2. Additionaly, the ABHD5 protein is thought to play a role in keratinocyte differentiation.

Mutations in this gene are associated with Chanarin-Dorfman syndrome, a triglyceride storage disease characterized by impaired oxidation of long-chain fatty acids. Abhd5 is expressed in many tissues, including brain, liver, skin, skeletal muscle and lymphocytes.

Alternate Names

abhydrolase domain containing 5, Abhydrolase domain-containing protein 5,1-acylglycerol-3-phosphate O-acyltransferase ABHD5, CDS, CGI58, EC 2.3.1.51, IECN2, Lipid droplet-binding protein CGI-58, MGC8731, NCIE2CGI-58

Gene Symbol

ABHD5

Additional Abhd5 Products

Product Documents for Abhd5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Abhd5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Abhd5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Abhd5 Antibody - BSA Free and earn rewards!

Have you used Abhd5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...