Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38981

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: MDEPSPLAQPLELNQHSRFIIGSVSEDNSEDEISNLVKLDLLEEKEGSLSPASVGSDTLSDL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Western Blot: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981] - Staining of human breast shows moderate positivity in cytoplasm in glandular cells.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981] - Staining of human cerebral cortex shows weak positivity in neuropil.
Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981]

Immunohistochemistry-Paraffin: Acetyl-CoA Carboxylase alpha/ACACA Antibody [NBP2-38981] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes.

Applications for Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Acetyl-CoA Carboxylase alpha/ACACA

Acetyl-CoA carboxylase 1 (ACC1) is a biotin dependent lipogenic enzyme that is highly expressed during adipogenesis. ACC1 catalyzes acetyl-CoA carboxylation, producing malonyl-CoA, a metabolite involved in energy homeostasis regulation. Malonyl-CoA is a two carbon donor in the synthesis of long-chain fatty acids and the elongation of fatty acids found in the cystol (1). ACC1 is regulated short-term by citrate, CoA, and palmitoyl-CoA through allosteric interactions. Nutrients and hormones can be both short-term (inducing reversible phosphorylations by such as AMPK) and long-term (transcription level regulation) regulators of ACC1 (2). Highly expressed in lipogenic tissues, ACC1 is found in liver, adipose, and lactating mammary gland (3). ACC1 has been implicated as a target in the development of anti-obesity drugs (4).

Long Name

Acetyl-Coenzyme A Carboxylase alpha

Alternate Names

ACACA, ACC1, ACCA, AcetylCoA Carboxylase alpha

Gene Symbol

ACACA

UniProt

Additional Acetyl-CoA Carboxylase alpha/ACACA Products

Product Documents for Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free and earn rewards!

Have you used Acetyl-CoA Carboxylase alpha/ACACA Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...