ACSL5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59645

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Mouse, Rat

Cited:

Rat

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Simple Western

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ACSL5(acyl-CoA synthetase long-chain family member 5) The peptide sequence was selected from the C terminal of ACSL5. Peptide sequence ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Mouse reactivity reported from a verified customer review.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ACSL5 Antibody - BSA Free

Western Blot: ACSL5 Antibody [NBP1-59645]

Western Blot: ACSL5 Antibody [NBP1-59645]

Western Blot: ACSL5 Antibody [NBP1-59645] - Detection of ACSL5 in rat lysate. Image provided by Dr. Eric Klett of UNC School of Medicine.
Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645]

Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645]

Immunohistochemistry-Paraffin: ACSL5 Antibody [NBP1-59645] - IHC analysis of human skeletal muscle tissue. Antibody concentration of 4 - 8ug/mL.
Western Blot: ACSL5 Antibody [NBP1-59645]

Western Blot: ACSL5 Antibody [NBP1-59645]

Western Blot: ACSL5 Antibody [NBP1-59645] - Human placenta tissue lysate. Antibody at a concentration of 1 ug/mL.
Simple Western: ACSL5 Antibody [NBP1-59645]

Simple Western: ACSL5 Antibody [NBP1-59645]

Simple Western: ACSL5 Antibody [NBP1-59645] - Simple Western analysis of mouse liver lysate. Simple Western image submitted by a verified customer review.

Applications for ACSL5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10 - 1:500

Immunohistochemistry-Paraffin

4 - 8 ug/mL

Western Blot

1.0 ug/ml
Application Notes
See Simple Western Antibody Database for Simple Western validation: Tested in Mouse liver lysate, separated by Size

Reviewed Applications

Read 2 reviews rated 4.5 using NBP1-59645 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ACSL5

ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Alternate Names

ACS2, ACS5FACL5 for fatty acid coenzyme A ligase 5, acyl-CoA synthetase long-chain family member 5, EC 6.2.1, EC 6.2.1.3, FACL5fatty acid coenzyme A ligase 5, fatty-acid-Coenzyme A ligase, long-chain 5, LACS 5, Long-chain acyl-CoA synthetase 5, long-chain fatty acid coenzyme A ligase 5, long-chain-fatty-acid--CoA ligase 5

Gene Symbol

ACSL5

UniProt

Additional ACSL5 Products

Product Documents for ACSL5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ACSL5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ACSL5 Antibody - BSA Free

Customer Reviews for ACSL5 Antibody - BSA Free (2)

4.5 out of 5
2 Customer Ratings
5 Stars
50%
4 Stars
50%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used ACSL5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 22 reviews Showing All
Filter By:
  • ACSL5 Antibody
    Name: Anonymous
    Application: Simple Western
    Sample Tested: mouse liver lysate
    Species: Mouse
    Verified Customer | Posted 07/01/2020
    ACSL5 Antibody - BSA Free NBP1-59645
    Bio-Techne Response
    This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
  • Name: Anonymous
    Application: Western Blot
    Sample Tested:
    Species: Rat
    Verified Customer | Posted 09/04/2013
    Western blot of INS832/13 cells after KD of Acsl5
    ACSL5 Antibody - BSA Free NBP1-59645

There are no reviews that match your criteria.

Showing  1 - 22 reviews Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...