Activin RIB/ALK-4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-39003

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (94%), Rat (96%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Activin RIB/ALK-4 Antibody - BSA Free

Western Blot: Activin RIB/ALK-4 Antibody [NBP2-39003]

Western Blot: Activin RIB/ALK-4 Antibody [NBP2-39003]

Western Blot: Activin RIB/ALK-4 Antibody [NBP2-39003] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG. Lane 4: Human Plasma. Lane 5: Human liver tissue
Immunocytochemistry/ Immunofluorescence: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunocytochemistry/ Immunofluorescence: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunocytochemistry/Immunofluorescence: Activin RIB/ALK-4 Antibody [NBP2-39003] - Immunofluorescent staining of human cell line A549 shows localization to cytosol.
Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody [NBP2-39003]

Immunohistochemistry-Paraffin: Activin RIB/ALK-4 Antibody [NBP2-39003] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.

Applications for Activin RIB/ALK-4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Activin RIB/ALK-4

Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.

Long Name

Activin Receptor IB

Alternate Names

ActivinRIB, ACVR1B, ALK-4, ALK4

Gene Symbol

ACVR1B

UniProt

Additional Activin RIB/ALK-4 Products

Product Documents for Activin RIB/ALK-4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Activin RIB/ALK-4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Activin RIB/ALK-4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Activin RIB/ALK-4 Antibody - BSA Free and earn rewards!

Have you used Activin RIB/ALK-4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...