Adipolin/FAM132A Antibody [Biotin]

Name: Adipolin/FAM132A Antibody [Biotin]
Brand: Novus Biologicals
SKU: NBP3-67240

Novus Biologicals | Catalog # NBP3-67240

Submit a review

Product Documents

Fc Region Site-Specific Biotinylated Antibody

View Available Formulations

Product Specifications
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunocytochemistry/ Immunofluorescence

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG

View all Adipolin/FAM132A Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: DAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHEFQELLKEATERRFSGLLD

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for Adipolin/FAM132A Antibody [Biotin]

Application

Recommended Usage

Immunohistochemistry

1:50 - 1:200

Application Notes

Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-70338.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: Adipolin/FAM132A

C1qTNF proteins constitute a highly conserved family of Acrp30/Adiponectin paralogs that share a modular organization comprising an N-terminal signal peptide, a short variable region, a collagenous domain and a C-terminal globular domain. C1qTNF proteins are predicted to have trimeric structures that assemble into hexameric and higher order molecular forms. C1qTNF3, also known as CORS26, is predominantly expressed in cartilage and is induced in mature adipocytes. C1qTNF10, also known as C1qL2, is a protein that shows 28% - 30% sequence identity with C1q subunits A, B, and C. It is predicted to contain one collagen-like and C1q domain. Mouse and human C1qTNF10 share over 90% amino acid sequence identity.

Long Name

Family with Sequence Similarity 132, Member A

Alternate Names

Adipose-Derived Insulin-Sensitizing Factor, C1qDC2, C1qTNF12, CTRP12, FAM132A

Gene Symbol

C1QTNF12

Additional Adipolin/FAM132A Products

Product Documents for Adipolin/FAM132A Antibody [Biotin]

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Adipolin/FAM132A Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Complement Pathway

Customer Reviews for Adipolin/FAM132A Antibody [Biotin]

There are currently no reviews for this product. Be the first to review Adipolin/FAM132A Antibody [Biotin] and earn rewards!

Have you used Adipolin/FAM132A Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image