Alkaline Phosphatase/ALPP Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-34056

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: NWYSDADVPASARQEGCQDIATQLISNMDI

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (83%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Alkaline Phosphatase/ALPP Antibody - BSA Free

Western Blot: Alkaline Phosphatase/ALPP Antibody [NBP2-34056]

Western Blot: Alkaline Phosphatase/ALPP Antibody [NBP2-34056]

Western Blot: Alkaline Phosphatase/ALPP Antibody [NBP2-34056] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15,10. Lane 2: Placenta
Immunohistochemistry-Paraffin: Alkaline Phosphatase/ALPP Antibody [NBP2-34056]

Immunohistochemistry-Paraffin: Alkaline Phosphatase/ALPP Antibody [NBP2-34056]

Immunohistochemistry-Paraffin: Alkaline Phosphatase/ALPP Antibody [NBP2-34056] - Staining in human placenta shows strong cytoplasmic and membranous staining in trophoblasts.
Alkaline Phosphatase/ALPP Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: Alkaline Phosphatase/ALPP Antibody [NBP2-34056]

Immunocytochemistry/ Immunofluorescence: Alkaline Phosphatase/ALPP Antibody [NBP2-34056]

Staining of human cell line HeLa shows localization to plasma membrane.

Applications for Alkaline Phosphatase/ALPP Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Alkaline Phosphatase/ALPP

Alkaline phosphatases are phosphodiesterases. The placental-specific isozyme of Alkaline Phosphatase (PLAP) is found in trophoblast cells of normal human mature placenta, seminomas of testis and ovarian carcinomas. Detection of alkaline phosphatase in serum is a marker for ovarian and testicular cancer.

Long Name

Alkaline Phosphatase, Placental Type

Alternate Names

Alkaline Phosphatase, PLAP, SEAP

Gene Symbol

ALPP

UniProt

Additional Alkaline Phosphatase/ALPP Products

Product Documents for Alkaline Phosphatase/ALPP Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Alkaline Phosphatase/ALPP Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Customer Reviews for Alkaline Phosphatase/ALPP Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Alkaline Phosphatase/ALPP Antibody - BSA Free and earn rewards!

Have you used Alkaline Phosphatase/ALPP Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Alkaline Phosphatase/ALPP Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking to use a placental alkaline phosphatase antibody for sorting syncytiotrophoblast material from female tissue. It looks like most people who use these antibodies use in-house versions and references for commercially available antibodies I've found are from the '80's. I noticed you have several different monoclonal antibodies and was hoping you could give me a little more information on them and potential applications they've been tested for. Also, do you have a biotinylated or fluorophore-conjugated version?

    A:

    None of our placental alkaline phosphatase antibodies are biotinylated or fluorchrome conjugated but we offer a number of kits for this application and our lab can do a custom conjugation as well, for an additional fee. NB600-750 is useful in FACS with human cells, so I would recommend this antibody for your experiment. We back the use of this antibody as stated on the datasheet with the 100% Novus Guarantee. If you have questions about another antibody, I will be happy to answer them.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...