APOBEC3D Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-57440

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to APOBEC3D (apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative)) The peptide sequence was selected from the N terminal of APOBEC3D (NP_689639). Peptide sequence: SYTWLCYEVKIKRGRSNLLWDTGVFRGPVLPKRQSNHRQEVYFRFENHAE The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for APOBEC3D Antibody - BSA Free

Western Blot: APOBEC3D Antibody [NBP1-57440]

Western Blot: APOBEC3D Antibody [NBP1-57440]

Western Blot: APOBEC3D Antibody [NBP1-57440] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml
Immunohistochemistry-Paraffin: APOBEC3D Antibody [NBP1-57440]

Immunohistochemistry-Paraffin: APOBEC3D Antibody [NBP1-57440]

Immunohistochemistry-Paraffin: APOBEC3D Antibody [NBP1-57440] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Applications for APOBEC3D Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

12 ug/ml

Immunohistochemistry-Paraffin

12 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: APOBEC3D

This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1 and inhibit retroviruses, such as HIV, by deaminating cytosine residues in nascent retroviral cDNA.

Alternate Names

APOBEC3DE, APOBEC3E, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D, apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3D (putative), apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3E pseudogene, ARP6, DNA dC->dU-editing enzyme APOBEC-3D, EC 3.5.4, EC 3.5.4.-, probable DNA dC->dU-editing enzyme APOBEC-3D

Entrez Gene IDs

140564 (Human)

Gene Symbol

APOBEC3D

UniProt

Additional APOBEC3D Products

Product Documents for APOBEC3D Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for APOBEC3D Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for APOBEC3D Antibody - BSA Free

There are currently no reviews for this product. Be the first to review APOBEC3D Antibody - BSA Free and earn rewards!

Have you used APOBEC3D Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...