Aquaporin-9 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-92558

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 211-295 of human Aquaporin-9 (NP_066190.2). SGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Aquaporin-9 Antibody - BSA Free

Immunohistochemistry-Paraffin: Aquaporin-9 Antibody - BSA Free [NBP2-92558]

Immunohistochemistry-Paraffin: Aquaporin-9 Antibody - BSA Free [NBP2-92558]

Immunohistochemistry-Paraffin: Aquaporin-9 Antibody [NBP2-92558] - Human liver cancer using Aquaporin-9 Rabbit pAb (NBP2-92558) at dilution of 1:150 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
Aquaporin-9 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Aquaporin-9 Antibody - BSA Free [NBP2-92558] -

Immunocytochemistry/ Immunofluorescence: Aquaporin-9 Antibody - BSA Free [NBP2-92558] - Immunofluorescence analysis of human liver using Aquaporin-9 Rabbit pAb at dilution of 1:200 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Aquaporin-9 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Aquaporin-9

The aquaporins are a family of water-selective membrane channels. The protein encoded by this gene allows passage of awide variety of noncharged solutes. It stimulates urea transport and osmotic water permeability; there arecontradicting reports about its role in providing glycerol permeability. The encoded protein may also play a role inspecialized leukocyte functions such as immunological response and bactericidal activity. (provided by RefSeq)

Alternate Names

AQP-9, Aquaglyceroporin-9, aquaporin 9, aquaporin-9, HsT17287, Small solute channel 1, SSC1aquaglyceroporin-9

Gene Symbol

AQP9

Additional Aquaporin-9 Products

Product Documents for Aquaporin-9 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Aquaporin-9 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aquaporin-9 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aquaporin-9 Antibody - BSA Free and earn rewards!

Have you used Aquaporin-9 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...