ARF6 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58310

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Bovine

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to ARF6(ADP-ribosylation factor 6) The peptide sequence was selected from the middle region of ARF6. Peptide sequence REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Use in Bovine reported in scientific literature (PMID:34367882)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ARF6 Antibody - BSA Free

Western Blot: ARF6 Antibody [NBP1-58310]

Western Blot: ARF6 Antibody [NBP1-58310]

Western Blot: ARF6 Antibody [NBP1-58310] - Titration: 0.2-1ug/ml, Positive Control: MCF7 cell Lysate
Immunohistochemistry-Paraffin: ARF6 Antibody [NBP1-58310]

Immunohistochemistry-Paraffin: ARF6 Antibody [NBP1-58310]

Immunohistochemistry-Paraffin: ARF6 Antibody [NBP1-58310] - Human Brain Tissue (Cerebellum), antibody concentration 5 ug/ml.
Western Blot: ARF6 Antibody [NBP1-58310]

Western Blot: ARF6 Antibody [NBP1-58310]

Western Blot: ARF6 Antibody [NBP1-58310] - Titration: 2 ug/ml Positive Control: Human NT-2 cells and Mouse WT brain.

Applications for ARF6 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ARF6

ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. This gene encodes a member of the human ARF gene family, which is part of the RAS superfamily. The ARF genes encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. The product of this gene is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling. A pseudogene of this gene is located on chromosome 7. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Long Name

ADP-ribosylation factor 6

Alternate Names

EC 3.6.5.2

Gene Symbol

ARF6

UniProt

Additional ARF6 Products

Product Documents for ARF6 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ARF6 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ARF6 Antibody - BSA Free

Customer Reviews for ARF6 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ARF6 Antibody - BSA Free and earn rewards!

Have you used ARF6 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ARF6 Antibody - BSA Free

Showing  1 - 22 FAQs Showing All
  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

  • Q: I saw another protein purified product ARF6, which is expressed in E.coli. Did you expressed that protein with n-myristoyltransferase co-transformation E.coli?

    A: We do not express the ARF6 protein with n-myristoyltransferase co-transformation E.coli.

  • Q: We would like to buy a myristoylated Arf6 purified protein. If you have myristoylated Arf6 purified protein, please let me know.

    A: Unfortunately, due to our expression system as well as Abnova's, we do not believe that these proteins have post-translational modifications similar to the endogenous protein

Showing  1 - 22 FAQs Showing All
View all FAQs for Antibodies
Loading...