ARHGEF4 Antibody [Biotin]

Name: ARHGEF4 Antibody [Biotin]
Brand: Novus Biologicals
SKU: NBP3-64744
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-64744

Submit a review

Product Documents

Fc Region Site-Specific Biotinylated Antibody

View Available Formulations

100% Guarantee

Product Specifications
Applications
Preparation & Storage
Background
Product Documents
Specific Notices

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG

View all ARHGEF4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. Each order represents a unique lot. Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Additional information may be available upon request. The antibody concentration is provided on the individual product label. For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for ARHGEF4 Antibody [Biotin]

Application

Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Application Notes

Recommended applications and dilutions are based on validated applications from the unconjugated base product NBP1-88857

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

0.1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: ARHGEF4

Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through Gucleotide exchange protein coupled receptors. Acts as guanine nucleotide exchange factor (GEF) for RhoA and RAC1 GTPases. Binding of APC may activate RAC1 GEF activity. The APC-ARHGEF4 complex seems to be involved in cell migration as well as in E-cadherin-mediated cell-cell adhesion. This protein is similar to rat collybistin protein. Alternative splicing of the gene generates two transcript variants which encode different isoforms.

Alternate Names

APC-stimulated guanine nucleotide exchange factor 1, Asef, Asef1, ASEFAPC-stimulated guanine nucleotide exchange factor, GEF4, KIAA1112, Rho guanine nucleotide exchange factor (GEF) 4, rho guanine nucleotide exchange factor 4, STM6

Gene Symbol

ARHGEF4

Additional ARHGEF4 Products

Product Documents for ARHGEF4 Antibody [Biotin]

Download Product Datasheets

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARHGEF4 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ARHGEF4 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review ARHGEF4 Antibody [Biotin] and earn rewards!

Have you used ARHGEF4 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image