ARL4 Antibody - Azide and BSA Free

Novus Biologicals | Catalog # NBP3-03356

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

Azide and BSA Free
View all ARL4 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 121-200 of human ARL4 (NP_001032241.1). ISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for ARL4 Antibody - Azide and BSA Free

Immunohistochemistry-Paraffin: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunohistochemistry-Paraffin: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunohistochemistry-Paraffin: ARL4 Antibody [NBP3-03356] - Paraffin-embedded human liver cancer using ARL4 antibody at dilution of 1:100 (40x lens).
Immunocytochemistry/ Immunofluorescence: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunocytochemistry/ Immunofluorescence: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunocytochemistry/Immunofluorescence: ARL4 Antibody [NBP3-03356] - Analysis of NIH-3T3 cells using ARL4 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunohistochemistry-Paraffin: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunohistochemistry-Paraffin: ARL4 Antibody [NBP3-03356] - Paraffin-embedded rat liver using ARL4 antibody at dilution of 1:100 (40x lens).
Immunohistochemistry-Paraffin: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunohistochemistry-Paraffin: ARL4 Antibody - Azide and BSA Free [NBP3-03356]

Immunohistochemistry-Paraffin: ARL4 Antibody [NBP3-03356] - Paraffin-embedded mouse heart using ARL4 antibody at dilution of 1:100 (40x lens).
ARL4 Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: ARL4 Antibody - Azide and BSA Free [ARL4] -

Immunocytochemistry/ Immunofluorescence: ARL4 Antibody - Azide and BSA Free [ARL4] - Immunofluorescence analysis of U-2 OS cells using ARL4 Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for ARL4 Antibody - Azide and BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Immunohistochemistry

1:50-1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

Azide and BSA Free

Preservative

0.01% Thimerosal

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ARL4

ADP-ribosylation factor-like 4A is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4A is similar to ARL4C and ARL4D and each has a nuclear localization signal and an unusually high guaninine nucleotide exchange rate. ARL4A is located in both the nuclear and extranuclear cell compartments. Multiple transcript variants encoding the same protein have been found for this gene.

Alternate Names

ADP-ribosylation factor-like 4A, ADP-ribosylation factor-like protein 4A, ARL4ADP-ribosylation factor-like 4

Gene Symbol

ARL4A

Additional ARL4 Products

Product Documents for ARL4 Antibody - Azide and BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ARL4 Antibody - Azide and BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for ARL4 Antibody - Azide and BSA Free

There are currently no reviews for this product. Be the first to review ARL4 Antibody - Azide and BSA Free and earn rewards!

Have you used ARL4 Antibody - Azide and BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies