ASH2L Antibody (10B6U5)

Novus Biologicals | Catalog # NBP3-16505

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10B6U5 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 529-628 of human ASH2L (Q9UBL3). AEKSLKQTPHSEIIFYKNGVNQGVAYKDIFEGVYFPAISLYKSCTVSINFGPCFKYPPKDLTYRPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ASH2L Antibody (10B6U5)

Western Blot: ASH2L Antibody (10B6U5) [NBP3-16505]

Western Blot: ASH2L Antibody (10B6U5) [NBP3-16505]

Western Blot: ASH2L Antibody (10B6U5) [NBP3-16505] - Analysis of extracts of various cell lines, using ASH2L Rabbit mAb (NBP3-16505) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.
ASH2L Antibody (10B6U5)

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded human cervix cancer tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ASH2L Antibody (10B6U5)

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] - Confocal imaging of C2C12 cells using ASH2L Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.
ASH2L Antibody (10B6U5)

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded mouse brain tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ASH2L Antibody (10B6U5)

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded rat brain tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ASH2L Antibody (10B6U5)

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] - Confocal imaging of NIH/3T3 cells using ASH2L Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.
ASH2L Antibody (10B6U5)

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded human colon carcinoma tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ASH2L Antibody (10B6U5)

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunohistochemistry: ASH2L Antibody (10B6U5) [NBP3-16505] - Immunohistochemistry analysis of ASH2L in paraffin-embedded mouse lung tissue using ASH2L Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ASH2L Antibody (10B6U5)

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] -

Immunocytochemistry/ Immunofluorescence: ASH2L Antibody (10B6U5) [NBP3-16505] - Confocal imaging of paraffin-embedded Mouse colon tissue using ASH2L Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for ASH2L Antibody (10B6U5)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: ASH2L

ASH2L is a component of the Set1/Ash2 histone methyltransferase (HMT) complex, a complex that specifically methylates 'Lys-4' of histone H3, but not if the neighboring 'Lys-9' residue is already methylated. May function as a transcriptional regulator. May play a rol

Alternate Names

ASH2, ash2 (absent, small, or homeotic)-like (Drosophila), ASH2L1ash2 (absent, small, or homeotic, Drosophila, homolog)-like, ASH2L2ASH2-like protein, Bre2, set1/Ash2 histone methyltransferase complex subunit ASH2

Gene Symbol

ASH2L

Additional ASH2L Products

Product Documents for ASH2L Antibody (10B6U5)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ASH2L Antibody (10B6U5)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ASH2L Antibody (10B6U5)

There are currently no reviews for this product. Be the first to review ASH2L Antibody (10B6U5) and earn rewards!

Have you used ASH2L Antibody (10B6U5)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...