ATPase Na+/K+ beta 3 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-38595

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for ATPase Na+/K+ beta 3 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunocytochemistry/ Immunofluorescence: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunocytochemistry/Immunofluorescence: ATPase Na+/K+ beta 3 Antibody [NBP2-38595] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody [NBP2-38595]

Immunohistochemistry-Paraffin: ATPase Na+/K+ beta 3 Antibody [NBP2-38595] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Applications for ATPase Na+/K+ beta 3 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATPase Na+/K+ beta 3

ATPase Na+/ K+ beta 3 is encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 3 subunit. This gene encodes a beta 3 subunit. A pseudogene exists for this gene, and it is located on chromosome 2. [provided by RefSeq]

Long Name

Sodium/potassium-transporting ATPase subunit beta-3

Alternate Names

ATP1B3, ATPB-3, CD antigen CD298

Gene Symbol

ATP1B3

UniProt

Additional ATPase Na+/K+ beta 3 Products

Product Documents for ATPase Na+/K+ beta 3 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for ATPase Na+/K+ beta 3 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for ATPase Na+/K+ beta 3 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATPase Na+/K+ beta 3 Antibody - BSA Free and earn rewards!

Have you used ATPase Na+/K+ beta 3 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...