ATPB Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-54700

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all ATPB Primary Antibodies »

Product Specifications

Immunogen

Synthetic peptides corresponding to ATP5B(ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide) The peptide sequence was selected from the N terminal of ATP5B. Peptide sequence PIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQ The peptide sequence for this immunogen was taken from within the described region.

Specificity

This product is specific to Subunit or Isoform: beta, mitochondrial.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

52 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for ATPB Antibody - BSA Free

Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using Proximal kidney tubules purfied from cortex at 1:1000.
Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700]

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700]

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.
Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700]

Western Blot: ATPB Antibody [NBP1-54700] - ATP5B antibody - N-terminal region validated by WB using HepG2 cell lysate at 1.25ug/ml.
Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700]

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700]

Immunohistochemistry-Paraffin: ATPB Antibody [NBP1-54700] - Human Intestine Epithelial cells of intestinal villus (Indicated with Arrows).

Applications for ATPB Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

4-8 ug/ml

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Protein A purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

1 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: ATPB

ATP5B is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). ATP5B is the beta subunit of the catalytic core.This gene encodes a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel consists of three main subunits (a, b, c). This gene encodes the beta subunit of the catalytic core. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Alternate Names

ATP synthase subunit beta, mitochondrial, ATP synthase, H+ transporting, mitochondrial F1 complex, beta polypeptide, ATPMB, ATPSBmitochondrial ATP synthase beta subunit, EC 3.6.3, EC 3.6.3.14, MGC5231, mitochondrial ATP synthetase, beta subunit

Entrez Gene IDs

506 (Human)

Gene Symbol

ATP5F1B

UniProt

P06576 (Human)

Additional ATPB Products

Product Documents for ATPB Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for ATPB Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for ATPB Antibody - BSA Free

Customer Reviews for ATPB Antibody - BSA Free

There are currently no reviews for this product. Be the first to review ATPB Antibody - BSA Free and earn rewards!

Have you used ATPB Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies