Aurora C Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-90819

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all Aurora C Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: AVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDF

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Aurora C Antibody - BSA Free

Immunohistochemistry: Aurora C Antibody [NBP1-90819]

Immunohistochemistry: Aurora C Antibody [NBP1-90819]

Immunohistochemistry: Aurora C Antibody [NBP1-90819] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
Aurora C Antibody - BSA Free Immunohistochemistry: Aurora C Antibody - BSA Free [NBP1-90819]

Immunohistochemistry: Aurora C Antibody - BSA Free [NBP1-90819]

Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.

Applications for Aurora C Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Aurora C

Aurora-C is a member of a novel family of serine/threonine kinases that have been identified as key regulators of the mitotic cell division process (1). Studies show that human Aurora-C is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere protein (INCENP), which are known passenger proteins. INCENP binds and activates Aurora-C in vivo and in vitro. Aurora-C co-expressed with INCENP elicits the phosphorylation of endogenous histone H3 in mammalian cells, even though this phosphorylation is not sufficient to establish chromosome condensation in interphase cells (2). Over-expression of an inactive mutant of Aurora C impaired the localization of Aurora C to the spindle midzone resulting in multinucleation which demonstrates that Aurora C is required for cytokinesis (3).

Long Name

Aurora kinase C

Alternate Names

AIE2, AIK3, AIRK3, ARK-3, ARK3, AURKC, Aurora 3, EC 2.7.11.1, STK13

Gene Symbol

AURKC

Additional Aurora C Products

Product Documents for Aurora C Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for Aurora C Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Aurora C Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Aurora C Antibody - BSA Free and earn rewards!

Have you used Aurora C Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies