AVPI1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80888

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all AVPI1 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: ASVVSEPPPWQAPIEARGRKQASANIFQDAELLQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALKR

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (87%), Rat (80%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for AVPI1 Antibody - BSA Free

Western Blot: AVPI1 Antibody [NBP1-80888]

Western Blot: AVPI1 Antibody [NBP1-80888]

Western Blot: AVPI1 Antibody [NBP1-80888] - Analysis in control (vector only transfected HEK293T lysate) and AVPI1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: AVPI1 Antibody [NBP1-80888]

Immunocytochemistry/ Immunofluorescence: AVPI1 Antibody [NBP1-80888]

Immunocytochemistry/Immunofluorescence: AVPI1 Antibody [NBP1-80888] - Staining of human cell line HeLa shows localization to nucleus & plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: AVPI1 Antibody [NBP1-80888]

Immunohistochemistry-Paraffin: AVPI1 Antibody [NBP1-80888]

Immunohistochemistry-Paraffin: AVPI1 Antibody [NBP1-80888] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Applications for AVPI1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: AVPI1

AVPI1 may be involved in MAP kinase activation, epithelial sodium channel (ENaC) down-regulation and cell cycling

Alternate Names

arginine vasopressin-induced 1, arginine vasopressin-induced protein 1, AVP-induced protein 1, PP5395, RP11-548K23.7, vasopressin-induced transcript, VIP32, VIT32

Entrez Gene IDs

60370 (Human)

Gene Symbol

AVPI1

Additional AVPI1 Products

Product Documents for AVPI1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for AVPI1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for AVPI1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review AVPI1 Antibody - BSA Free and earn rewards!

Have you used AVPI1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies