B4GALT7 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88652

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Hamster - Cricetulus (Chinese Hamster)

Predicted:

Mouse (97%), Rat (98%). Backed by our 100% Guarantee.

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Cited:

Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PEHWEEDASWGPHRLAVLVPFRERFEELLVFVPHMRRFLSRKKIRHHIYVLNQVDHFRFNRAALINVGFLESSNSTDYIAMHDVDLLPLNEELDYGFPEAGPFHVASPELHPLYHYKTYVG

Reactivity Notes

Chinese Hamster reactivity reported in scientific literature (PMID: 31278392).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody [NBP1-88652]

Western Blot: B4GALT7 Antibody [NBP1-88652]

Western Blot: B4GALT7 Antibody [NBP1-88652] - Analysis in human cell line HDLM-2.
B4GALT7 Antibody

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human placenta shows moderate granular cytoplasmic positivity in trophoblastic cells.
B4GALT7 Antibody

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.
B4GALT7 Antibody

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
B4GALT7 Antibody

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] -

Immunohistochemistry-Paraffin: B4GALT7 Antibody [NBP1-88652] - Staining of human skin shows no positivity in squamous epithelial cells as expected.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

Down-regulation of B4GALT7 results in DNA damage and arrests the cell cycle at the G2/M phase.(A–B) p-ATM and p-H2A. X protein levels in SNU-423 and SK-Hep-1 cells transfected with shB4GALT7 or shNC, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. (C) Cell cycle analysis in SNU-423 and SK-Hep-1 cells after shRNA mediated B4GALT7 inhibition. Mean +/- SD for three independent experiments are demonstrated. (D–E) p-Chk2, p-Wee1, p-cdc2 and cyclin B1 protein levels in B4GALT7-downregulation SNU-423 and SK-Hep-1 cells, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

B4GALT7 is highly expressed in HCC tissues.(A) B4GALT7 expression levels in three GEO datasets, GSE14520, GSE25097 and GSE84402. (B) B4GALT7 levels in the TCGA database. (C) Survival probability of HCC patients with different expression of B4GALT7. The expression of B4GALT7 was analyzed by (D) western blotting and (E) real-time PCR in 10 pairs HCC samples and para-tumor specimens. (F) Representative immunohistochemical staining results of B4GALT7 based on the HPA database. (G) The expression landscape of B4GALT7 in the TIMER2.0 database. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

The effects of B4GALT7 and miR-338-3p on HCC cell invasion.(A) Matrigel-based transwell assay was conducted in HCC cells transfected with pEX-3/vector, pEX-3/B4GALT7, and co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (B) Western blotting assay revealed the expression levels of EMT marker proteins can be reversed when co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (C) Representative western blots of EMT marker protein levels in SNU-423 cells transfected with shB4GALT7 or shNC, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

Down-regulation of B4GALT7 inhibits HCC cell proliferative abilities in vitro.(A) qPCR and (B) Western blotting analysis of the expression of B4GALT7 in HCC cells (SNU-423, SMMC-7721, SK-Hep-1, HepG2, Huh-7) and normal liver cell HL-7702. (C) Representative pictures of the green fluorescence intensity of HCC cells after transfected with shRNA vectors to mediate B4GALT7 inhibition. (D) qPCR and (E) Western blotting analysis of B4GALT7 expression in HCC cells after transfected as in C. Down-regulation of B4GALT7 inhibits the proliferative abilities of HCC cells (SNU-423, SK-Hep-1) determined by (F) MTT assay and (G) Colony formation assay. (H) Representative pictures of flow cytometry analysis of apoptosis stained with Annexin V-APC and 7-AAD in HCC cells transfected as in C. Scale bar: 100 um. Mean +/- SD for three independent experiments are demonstrated. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

Down-regulation of B4GALT7 inhibits HCC cell proliferative abilities in vitro.(A) qPCR and (B) Western blotting analysis of the expression of B4GALT7 in HCC cells (SNU-423, SMMC-7721, SK-Hep-1, HepG2, Huh-7) and normal liver cell HL-7702. (C) Representative pictures of the green fluorescence intensity of HCC cells after transfected with shRNA vectors to mediate B4GALT7 inhibition. (D) qPCR and (E) Western blotting analysis of B4GALT7 expression in HCC cells after transfected as in C. Down-regulation of B4GALT7 inhibits the proliferative abilities of HCC cells (SNU-423, SK-Hep-1) determined by (F) MTT assay and (G) Colony formation assay. (H) Representative pictures of flow cytometry analysis of apoptosis stained with Annexin V-APC and 7-AAD in HCC cells transfected as in C. Scale bar: 100 um. Mean +/- SD for three independent experiments are demonstrated. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

The reciprocal suppression effects of B4GALT7 and miR-338-3p.(A) The potential interaction between B4GALT7 and miR-338-3p predicted by TargetScan. (B) Expression levels of miR-338-3p in HCC cells (SNU-423, SK-Hep-1) and normal liver cell HL-7702. (C) Dual luciferase reporter assay demonstrated the luciferase activities in HEK-293T and SNU-423 cells following the indicated transfection. (D–E) Expression levels of miR-338-3p in SNU-423 and SK-Hep-1 cells with B4GALT7 overexpression and after shRNA mediated B4GALT7 inhibition. (F–G) qPCR and (H) Western blotting analysis of B4GALT7 expression in SNU-423 and SK-Hep-1 cells after transfected with miR-338-3p mimics and inhibitor. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

The effects of B4GALT7 and miR-338-3p on HCC cell invasion and migration.(A–B) Wound healing assay, matrigel-free and matrigel-based transwell assays were performed in SNU-423 and SK-Hep-1 cells transfected with shNC, shB4GALT7, and co-transfected with sh-B4GALT7 and the miR-338-3p inhibitor. Migration of the cells to the wound was photographed at 0 h and 48 h. Scale bar: 100 um. (C) Western blotting assay revealed the expression levels of EMT marker proteins and the phosphorylation status of signaling proteins can be rescued when co-transfected with sh-B4GALT7 and the miR-338-3p inhibitor. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.
B4GALT7 Antibody - BSA Free

Western Blot: B4GALT7 Antibody - BSA Free [NBP1-88652] -

The effects of B4GALT7 and miR-338-3p on HCC cell invasion.(A) Matrigel-based transwell assay was conducted in HCC cells transfected with pEX-3/vector, pEX-3/B4GALT7, and co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (B) Western blotting assay revealed the expression levels of EMT marker proteins can be reversed when co-transfected with pEX-3/B4GALT7 and miR-338-3p mimics. (C) Representative western blots of EMT marker protein levels in SNU-423 cells transfected with shB4GALT7 or shNC, and further transfected with pEX-3/B4GALT7 or pEX-3/vector. *, P < 0.05; **, P < 0.01. Image collected and cropped by CiteAb from the following open publication (https://pubmed.ncbi.nlm.nih.gov/38025683), licensed under a CC-BY license. Not internally tested by Novus Biologicals.

Applications for B4GALT7 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 -1:200

Immunohistochemistry-Paraffin

1:50 - 1:200

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: B4GALT7

B4GALT7 - xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7 (galactosyltransferase I)

Long Name

UDP-Gal:Beta-GlcNAc Beta-1,4-Galactosyltransferase 7

Alternate Names

b4Gal-T7, beta-1,4-galactosyltransferase 7, Beta-1,4-GalTase 7, beta4Gal-T7, beta4GalT-VII, EC 2.4.1.-, EDSP1, EDSSLA, EDSSPD1, proteoglycan UDP-galactose:beta-xylose beta1,4-galactosyltransferase I, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 7, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 7, XGALT1, XGALT-1, XGALT1beta-1,4-galactosyltransferase VII, XGPT, XGPT1, xylosylprotein beta 1,4-galactosyltransferase, polypeptide 7(galactosyltransferase I)

Gene Symbol

B4GALT7

Additional B4GALT7 Products

Product Documents for B4GALT7 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for B4GALT7 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for B4GALT7 Antibody - BSA Free

Customer Reviews for B4GALT7 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review B4GALT7 Antibody - BSA Free and earn rewards!

Have you used B4GALT7 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...