BAF180/PB1 Antibody (9A8C4)

Novus Biologicals | Catalog # NBP3-15258

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 9A8C4 expressed in HEK293
View all BAF180/PB1 Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 530-680 of human BAF180/PB1 (Q86U86). VLEAREPGSGRRLCDLFMVKPSKKDYPDYYKIILEPMDLKIIEHNIRNDKYAGEEGMIEDMKLMFRNARHYNEEGSQVYNDAHILEKLLKEKRKELGPLPDDDDMASPKLKLSRKSGISPKKSKYMTPMQQKLNEVYEAVKNYTDKRGRRL

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BAF180/PB1 Antibody (9A8C4)

Western Blot: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Western Blot: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Western Blot: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] - Western blot analysis of extracts of various cell lines, using BAF180/PB1 Rabbit mAb (NBP3-15258) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] - Immunohistochemistry of paraffin-embedded mouse kidney using BAF180/PB1 Rabbit mAb (NBP3-15258) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] - Immunohistochemistry of paraffin-embedded rat ovary using BAF180/PB1 Rabbit mAb (NBP3-15258) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258]

Immunohistochemistry-Paraffin: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] - Immunohistochemistry of paraffin-embedded human appendix using BAF180/PB1 Rabbit mAb (NBP3-15258) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
BAF180/PB1 Antibody (9A8C4)

Immunohistochemistry: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] -

Immunohistochemistry: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] - Immunohistochemistry analysis of paraffin-embedded Human colon using BAF180/PB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
BAF180/PB1 Antibody (9A8C4)

Immunohistochemistry: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] -

Immunohistochemistry: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] - Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer using BAF180/PB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.
BAF180/PB1 Antibody (9A8C4)

Immunohistochemistry: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] -

Immunohistochemistry: BAF180/PB1 Antibody (9A8C4) [NBP3-15258] - Immunohistochemistry analysis of paraffin-embedded Human spleen using BAF180/PB1 Rabbit mAb at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris/EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for BAF180/PB1 Antibody (9A8C4)

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BAF180/PB1

The SMARCs (SWI/SNF-related, matrix-associated, actin-dependent regulators of chromatin), and BAFs (BRG1-associated factors), have been identified as components of the mammalian SWI/SNF-like chromatin-remodeling protein complexes. These multi-protein complexes are proposed to function as ATP-driven motors that translocate along DNA and destabilize nucleosomal structures to facilitate transcription factor binding. PB1/BAF180 is a component of the SWI/SNF-B (PBAF) complex. It contains six bromodomains which are defined by a 110 amino-acid module that interacts with acetylated lysine and is found in many chromatin binding proteins and histone acetyltransferases. PB1/BAF180 has been proposed to function as a tumor suppressor protein. Recently, PB1/BAF180 has been found to play a role in mediating cell cycle arrest in response to DNA damage via the regulation of the tumor suppressor p21. Alternate names for PB1/BAF180 include protein polybromo-1, polybromo-1D, BRG1-associated factor 180, hPB1, and PBRM1.

Long Name

Protein polybromo-1

Alternate Names

BAF180, hPB1, PB1, PBRM1, Polybromo-1D

Gene Symbol

PBRM1

Additional BAF180/PB1 Products

Product Documents for BAF180/PB1 Antibody (9A8C4)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BAF180/PB1 Antibody (9A8C4)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BAF180/PB1 Antibody (9A8C4)

There are currently no reviews for this product. Be the first to review BAF180/PB1 Antibody (9A8C4) and earn rewards!

Have you used BAF180/PB1 Antibody (9A8C4)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies