BCAP31 Antibody (7R10K2)

Novus Biologicals | Catalog # NBP3-16101

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 7R10K2 expressed in HEK293
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human BCAP31 (P51572). RNLYIAGFSLLLSFLLRRLVTLISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEENRSLKADLQKLKDELASTKQ

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BCAP31 Antibody (7R10K2)

Western Blot: BCAP31 Antibody (7R10K2) [NBP3-16101]

Western Blot: BCAP31 Antibody (7R10K2) [NBP3-16101]

Western Blot: BCAP31 Antibody (7R10K2) [NBP3-16101] - Western blot analysis of extracts of various cell lines, using BCAP31 Rabbit mAb (NBP3-16101) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: BCAP31 Antibody (7R10K2) [NBP3-16101]

Western Blot: BCAP31 Antibody (7R10K2) [NBP3-16101]

Western Blot: BCAP31 Antibody (7R10K2) [NBP3-16101] - Western blot analysis of extracts of various cell lines, using BCAP31 Rabbit mAb (NBP3-16101) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
BCAP31 Antibody (7R10K2)

Immunocytochemistry/ Immunofluorescence: BCAP31 Antibody (7R10K2) [NBP3-16101] -

Immunocytochemistry/ Immunofluorescence: BCAP31 Antibody (7R10K2) [NBP3-16101] - Immunofluorescence analysis of U-2 OS cells using BCAP31 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
BCAP31 Antibody (7R10K2)

Immunocytochemistry/ Immunofluorescence: BCAP31 Antibody (7R10K2) [BCAP31] -

Immunocytochemistry/ Immunofluorescence: BCAP31 Antibody (7R10K2) [BCAP31] - Immunofluorescence analysis of U-2 OS cells using BCAP31 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for BCAP31 Antibody (7R10K2)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: BAP31

BAP31 (B Cell Receptor Associated Protein, 28 kDa) is a multiple membrane spanning protein of the endoplasmic reticulum. It has been shown to form both homo and hetero oligomers with the closely related BAP29, and is a potential apoptotic regulator as a predicted BCL2/BCLXL associated protein. In the C terminal domain of BAP31, there are two identical recognition sites for initiator Caspases 1 and 8 of the programmed death cascade. It is hypothesized that BAP31 plays a role in the transport of selected proteins to the Golgi apparatus. BAP31 has also been shown to control expression of CFTR (cystic fibrosis transmembrane conductance regulator). It is believed that interference with the expression or function of BAP31 in epithelial cells may be a way to circumvent the chloride channel defect in cystic fibrosis.

Long Name

B-cell Receptor-associated Protein 31

Alternate Names

6C6-Ag, BCAP31

Gene Symbol

BCAP31

Additional BAP31 Products

Product Documents for BCAP31 Antibody (7R10K2)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for BCAP31 Antibody (7R10K2)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BCAP31 Antibody (7R10K2)

There are currently no reviews for this product. Be the first to review BCAP31 Antibody (7R10K2) and earn rewards!

Have you used BCAP31 Antibody (7R10K2)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...