BRF2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88355

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all BRF2 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: VLTTTFSDEGNLREVTYSRSTGENEQVSRSQQRGLRRVRDLCRVLQLPPTFEDTAVAYYQQAYRHSGIRA

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (87%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for BRF2 Antibody - BSA Free

Immunohistochemistry-Paraffin: BRF2 Antibody [NBP1-88355]

Immunohistochemistry-Paraffin: BRF2 Antibody [NBP1-88355]

Immunohistochemistry-Paraffin: BRF2 Antibody [NBP1-88355] - Staining of human rectum shows strong nuclear positivity in glandular cells.
BRF2 Antibody - BSA Free Western Blot: BRF2 Antibody - BSA Free [NBP1-88355]

Western Blot: BRF2 Antibody - BSA Free [NBP1-88355]

Analysis in control (vector only transfected HEK293T lysate) and BRF2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

Applications for BRF2 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:200 - 1:500

Immunohistochemistry-Paraffin

1:200 - 1:500

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: BRF2

BRF2 is one of the multiple subunits of the RNA polymerase III transcription factor complex required for transcription of genes with promoter elements upstream of the initiation site. BRF2 is directly recruited to the TATA-box of polymerase III small nuclear RNA gene promoters through its interaction with the TATA-binding protein.

Alternate Names

B-related factor 2, BRF-2, BRF2, subunit of RNA polymerase III transcription initiation factor, BRF1-like, BRFUhTFIIIB50, FLJ11052, hBRFU, TFIIIB50RNA polymerase III transcription initiation factor BRFU, transcription factor IIB- related factor, TFIIIB50, transcription factor IIIB 50 kDa subunit

Gene Symbol

BRF2

Additional BRF2 Products

Product Documents for BRF2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for BRF2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for BRF2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review BRF2 Antibody - BSA Free and earn rewards!

Have you used BRF2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies