c-Myb Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-80306

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human, Avian

Cited:

Human, Avian

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence, Knockdown Validated

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence, IF/IHC

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human MYB. Peptide sequence YDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGTDDWKVIANYLPNRTD. The peptide sequence for this immunogen was taken from within the described region.

Reactivity Notes

Avian reactivity reported in scientific literature (PMID: 31430446).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for c-Myb Antibody - BSA Free

Western Blot: c-Myb Antibody [NBP1-80306]

Western Blot: c-Myb Antibody [NBP1-80306]

Western Blot: c-Myb Antibody [NBP1-80306] - WB Suggested Anti-MYB Antibody Titration: 0.2-1 ug/ml. Positive Control: HepG2 cell lysate
Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306]

Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306]

Immunohistochemistry-Paraffin: c-Myb Antibody [NBP1-80306] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: c-Myb Antibody [NBP1-80306]

Western Blot: c-Myb Antibody [NBP1-80306]

Western Blot: c-Myb Antibody [NBP1-80306] - c-Myb in MOLT-4 cells transfected with siRNA. Image from verified customer review.
Western Blot: c-Myb Antibody [NBP1-80306]

Western Blot: c-Myb Antibody [NBP1-80306]

Western Blot: c-Myb Antibody [NBP1-80306] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml

Applications for c-Myb Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml
Application Notes
Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID: 31430446).

Reviewed Applications

Read 1 review rated 5 using NBP1-80306 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: c-Myb

The c-Myb proto-oncogene is a 75 kDa protein involved in growth regulation and differentiation in many different cell types but it is predominantly expressed in immature hemopoietic cells where it plays an important role in cell proliferation. c-Myb activity is directly regulated by cyclin D1 and CDKs and it is believed that c-Myb activity is regulated during the cell cycle in hematopoietic cells (2). Disrupting c-myb function might, therefore, prove an effective therapeutic strategy for controlling leukemic cell growth (3). c-Myb binds to promoter sequences of genes such as c-Myc or Bcl-2 that are expressed in cutaneous T-cell lymphoma.

Alternate Names

Cmyb, c-myb, c-myb protein (140 AA), c-myb_CDS, c-myb10A_CDS, c-myb13A_CDS, c-myb14A_CDS, c-myb8B_CDS, efg, Proto-oncogene c-Myb, transcriptional activator Myb, v-myb avian myeloblastosis viral oncogene homolog, v-myb myeloblastosis viral oncogene homolog (avian)

Gene Symbol

MYB

Additional c-Myb Products

Product Documents for c-Myb Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for c-Myb Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for c-Myb Antibody - BSA Free

Customer Reviews for c-Myb Antibody - BSA Free (1)

5 out of 5
1 Customer Rating
5 Stars
100%
4 Stars
0%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used c-Myb Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Name: Anonymous
    Application: Western Blot
    Sample Tested: Whole cell lysate from MOLT-4 cells, in lysis buffer
    Species: Human
    Verified Customer | Posted 07/17/2014
    WB for c-Myb in MOLT-4 cells transfected with siRNA
    c-Myb Antibody - BSA Free NBP1-80306

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for c-Myb Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We recently ordered the anti c-myb antibody and I note that on the blot the MW of the band is 36kDa though c-myb should have a MW of 75 kDa. How was the specificity verified? Is the immunizing antigen available for performing a preabsorption negative control?

    A: c-Myb has at least 12 known isoforms and one of these isoforms is around 37 kDa. There is a blocking peptide available for NBP1-80306. The catalog number will be NBP1-80306PEP

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...