C1QTNF8 Antibody [Biotin]

Name: C1QTNF8 Antibody [Biotin]
Brand: Novus Biologicals
SKU: NBP3-71902
Price: 749 USD
Availability: InStock

Novus Biologicals | Catalog # NBP3-71902

Submit a review

Product Documents

Fc Region Site-Specific Biotinylated Antibody

View Available Formulations

100% Guarantee

Product Specifications
Applications
Preparation & Storage
Background
Product Documents
Specific Notices
Research Areas

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Biotin

Antibody Source

Polyclonal Rabbit IgG

View all CTRP8/C1qTNF8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ACRRAYAAFSVGRREGLHSSDHFQAVPFDTELVNLDGAFDLAAGRFLCTV

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

This conjugate is made on demand and is not held in inventory. As a result, each order represents a unique lot.

Successful site-specific biotin conjugation is confirmed by reducing SDS-PAGE, revealing a mobility shift of the antibody heavy-chain when biotin is covalently attached. Free biotin from the conjugation process has been removed. The antibody concentration is provided on the individual product label.

For specialized conjugation needs, like large quantities, and specific concentrations, bulk and custom antibody conjugation services are available.

Applications for C1QTNF8 Antibody [Biotin]

Application

Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Application Notes

Recommended applications and dilutions are based on validated applications from the unconjugated base product

NBP2-34167

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

40% glycerol and PBS (pH 7.2).

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C in the dark.

Background: CTRP8/C1qTNF8

C1qTNF proteins constitute a highly conserved family of Acrp30/Adiponectin paralogs that share a modular organization comprising an N-terminal signal peptide, a short variable region, a collagenous domain and a C-terminal globular domain. C1qTNF proteins are predicted to have trimeric structures that assemble into hexameric and higher order molecular forms. C1qTNF3, also known as CORS26, is predominantly expressed in cartilage and is induced in mature adipocytes. C1qTNF10, also known as C1qL2, is a protein that shows 28% - 30% sequence identity with C1q subunits A, B, and C. It is predicted to contain one collagen-like and C1q domain. Mouse and human C1qTNF10 share over 90% amino acid sequence identity.

Long Name

C1q And Tumor Necrosis Factor Related Protein 8

Alternate Names

C1q And TNF Related 8, C1qTNF8, UNQ5829

Gene Symbol

C1QTNF8

Additional CTRP8/C1qTNF8 Products

Product Documents for C1QTNF8 Antibody [Biotin]

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for C1QTNF8 Antibody [Biotin]

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Related Research Areas

Complement Pathway

Customer Reviews for C1QTNF8 Antibody [Biotin]

There are currently no reviews for this product. Be the first to review C1QTNF8 Antibody [Biotin] and earn rewards!

Have you used C1QTNF8 Antibody [Biotin]?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image