C4 binding protein B Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-58983

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to C4BPB (complement component 4 binding protein, beta) The peptide sequence was selected from the N terminal of C4BPB. Peptide sequence CCLMVAWRVSASDAEHCPELPPVDNSIFVAKEVEGQILGTYVCIKGYHLV. The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for C4 binding protein B Antibody - BSA Free

Western Blot: C4 binding protein B Antibody [NBP1-58983]

Western Blot: C4 binding protein B Antibody [NBP1-58983]

Western Blot: C4 binding protein B Antibody [NBP1-58983] - This Anti-C4BPB antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry-Paraffin: C4 binding protein B Antibody [NBP1-58983]

Immunohistochemistry-Paraffin: C4 binding protein B Antibody [NBP1-58983]

Immunohistochemistry-Paraffin: C4 binding protein B Antibody [NBP1-58983] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Western Blot: C4 binding protein B Antibody [NBP1-58983]

Western Blot: C4 binding protein B Antibody [NBP1-58983]

Western Blot: C4 binding protein B Antibody [NBP1-58983] - Analysis of 721_B cell lysate. Antibody Dilution: 1.0 ug/ml C4BPB is supported by BioGPS gene expression data to be expressed in 721_B.

Applications for C4 binding protein B Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: C4 binding protein B

C4BPB is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. A single, unique beta-chain encoded by this gene assembles with seven identical alpha-chains into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. C4b-binding protein has a regulatory role in the coagulation system also, mediated through the beta-chain binding of protein S, a vitamin K-dependent protein that serves as a cofactor of activated protein C.

Alternate Names

C4b binding protein, beta chain, C4b-binding protein beta chain, C4BP, complement component 4 binding protein, beta, complement component 4 binding protein, beta chain, complement component 4-binding protein, beta

Gene Symbol

C4BPB

UniProt

Additional C4 binding protein B Products

Product Documents for C4 binding protein B Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for C4 binding protein B Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for C4 binding protein B Antibody - BSA Free

There are currently no reviews for this product. Be the first to review C4 binding protein B Antibody - BSA Free and earn rewards!

Have you used C4 binding protein B Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...