Calpain 13 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-14435

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to the amino acids: ISRELLHLVTLRYSDSVGRVSFPSLVCFLMRLEAMAKTFRNLSKDGKGLYLTEMEWMSLVMYN

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Calpain 13 Antibody - BSA Free

Immunohistochemistry-Paraffin: Calpain 13 Antibody [NBP2-14435]

Immunohistochemistry-Paraffin: Calpain 13 Antibody [NBP2-14435]

Immunohistochemistry-Paraffin: Calpain 13 Antibody [NBP2-14435] - Staining of human bronchus shows moderate cytoplasmic and membranous positivity in respiratory epithelial cells.

Applications for Calpain 13 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calpain 13

Calpains are a family of cytosolic calcium-activated cysteine proteases involved in a variety of cellular processes including apoptosis, cell division, modulation of integrin-cytoskeletal interactions, and synaptic plasticity (Dear et al., 2000 [PubMed 10964513]). CAPN13 belongs to the calpain large subunit family.[supplied by OMIM]

Alternate Names

Calcium-activated neutral proteinase 13, calpain 13, calpain-13, CANP 13, EC 3.4.22.-, FLJ23523

Gene Symbol

CAPN13

Additional Calpain 13 Products

Product Documents for Calpain 13 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calpain 13 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calpain 13 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calpain 13 Antibody - BSA Free and earn rewards!

Have you used Calpain 13 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Calpain 13 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking for a calpain 13 antibody to be used for immunohistochemistry of paraffin embedded tissue. I am looking for reactivity in horse, cat, and mouse. I know that horse and cat may not be verified, but I was hoping you could point me to what you would best recommend. This will be tested in lung tissue.

    A: The immunogen for NBP2-14435 shares 81% similarity with mouse, 85% similarity with cat and 75% similarity with horse. This antibody is predicted to cross-react with these 3 species and will be the best product we have for your species and application.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...