Calponin 2 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-13848

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: PKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Calponin 2 Antibody - BSA Free

Western Blot: Calponin 2 Antibody [NBP2-13848]

Western Blot: Calponin 2 Antibody [NBP2-13848]

Western Blot: Calponin 2 Antibody [NBP2-13848] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Calponin 2 Antibody [NBP2-13848]

Immunocytochemistry/ Immunofluorescence: Calponin 2 Antibody [NBP2-13848]

Immunocytochemistry/Immunofluorescence: Calponin 2 Antibody [NBP2-13848] - Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
Immunohistochemistry-Paraffin: Calponin 2 Antibody [NBP2-13848]

Immunohistochemistry-Paraffin: Calponin 2 Antibody [NBP2-13848]

Immunohistochemistry-Paraffin: Calponin 2 Antibody [NBP2-13848] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal and non-germinal center cells.

Applications for Calponin 2 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calponin 2

Calponin, a 34 kDa protein, regulates smooth muscle cell contraction and is a marker of smooth muscle cell differentiation. Calponin, an actin- and tropomyosin-binding protein, is characterized as an inhibitory factor of smooth-muscle actomyosin activity. Calponin is implicated in the regulation of smooth muscle contraction through its interaction with F-actin and inhibition of the actin-activated MgATPase activity of phosphorylated myosin.Both properties are lost following phosphorylation (primarily at serine 175) by protein kinase C or calmodulin-dependent protein kinase II. The three forms of Calponin, Calponin 1 (basic Calponin), Calponin 2 (neutral Calponin), and Calponin 3 (acidic Calponin) are found in smooth muscle tissue. Additionally, Calponin 2 is found in heart muscle tissue and Calponin 3 is found in the brain.

Alternate Names

calponin 2, Calponin H2, smooth muscle, calponin-2, Neutral calponin

Gene Symbol

CNN2

Additional Calponin 2 Products

Product Documents for Calponin 2 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calponin 2 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for Calponin 2 Antibody - BSA Free

Customer Reviews for Calponin 2 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calponin 2 Antibody - BSA Free and earn rewards!

Have you used Calponin 2 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...