Calumenin Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-87120

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit

Format

BSA Free
Loading...

Product Specifications

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Calumenin. Peptide sequence: SDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALV The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Scientific Data Images for Calumenin Antibody - BSA Free

Western Blot: Calumenin Antibody [NBP2-87120]

Western Blot: Calumenin Antibody [NBP2-87120]

Western Blot: Calumenin Antibody [NBP2-87120] - WB Suggested Anti-CALU Antibody. Titration: 1.0 ug/ml. Positive Control: U937 Whole Cell
Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120] - Rabbit Anti-CALU Antibody. Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.
Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120]

Immunohistochemistry-Paraffin: Calumenin Antibody [NBP2-87120] - Rabbit Anti-CALU Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Thyroid Tissue. Observed Staining: Cytoplasm in follicular cells. Primary Antibody Concentration: 1:100. Other Working Concentrations: 1:600.

Applications for Calumenin Antibody - BSA Free

Application
Recommended Usage

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Calumenin

The product of this gene is a calcium-binding protein localized in the endoplasmic reticulum (ER) and it is involved in such ER functions as protein folding and sorting. This protein belongs to a family of multiple EF-hand proteins (CERC) that include reticulocalbin, ERC-55, and Cab45 and the product of this gene. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Alternate Names

calumenin, Crocalbin, crocalbin-like protein, FLJ90608, IEF SSP 9302, multiple EF-hand protein

Gene Symbol

CALU

Additional Calumenin Products

Product Documents for Calumenin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Calumenin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Calumenin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Calumenin Antibody - BSA Free and earn rewards!

Have you used Calumenin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...