CaM Kinase II delta Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-88211

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (97%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: MDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CaM Kinase II delta Antibody - BSA Free

CaM Kinase II delta Antibody - BSA Free Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Staining of human heart muscle shows moderate cytoplasmic positivity in cardiomyocytes.
CaM Kinase II delta Antibody - BSA Free Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil and neurons.
CaM Kinase II delta Antibody - BSA Free Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Staining of human cerebellum shows moderate cytoplasmic positivity in Purkinje cells.
CaM Kinase II delta Antibody - BSA Free Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Immunohistochemistry-Paraffin: CaM Kinase II delta Antibody - BSA Free [NBP1-88211]

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Applications for CaM Kinase II delta Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CaM Kinase II delta

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a delta chain. Four alternatively spliced transcript variants that encode three different isoforms have been characterized to date. Distinct isoforms of this chain have different expression patterns.

Long Name

Calcium/calmodulin-dependent Protein Kinase II delta Subunit

Alternate Names

CAMK2D

Gene Symbol

CAMK2D

Additional CaM Kinase II delta Products

Product Documents for CaM Kinase II delta Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CaM Kinase II delta Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CaM Kinase II delta Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CaM Kinase II delta Antibody - BSA Free and earn rewards!

Have you used CaM Kinase II delta Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies