Catenin alpha 1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-33456

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (98%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Catenin alpha 1 Antibody - BSA Free

Western Blot: Catenin alpha 1 Antibody [NBP2-33456]

Western Blot: Catenin alpha 1 Antibody [NBP2-33456]

Western Blot: Catenin alpha 1 Antibody [NBP2-33456] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Catenin alpha 1 Antibody [NBP2-33456]

Immunocytochemistry/ Immunofluorescence: Catenin alpha 1 Antibody [NBP2-33456]

Immunocytochemistry/Immunofluorescence: Catenin alpha 1 Antibody [NBP2-33456] - Immunofluorescent staining of human cell line CACO-2 shows localization to plasma membrane & cell junctions.
Immunohistochemistry: Catenin alpha 1 Antibody [NBP2-33456]

Immunohistochemistry: Catenin alpha 1 Antibody [NBP2-33456]

Immunohistochemistry: Catenin alpha 1 Antibody [NBP2-33456] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Applications for Catenin alpha 1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Catenin alpha 1

Cadherin and catenin compose cell adhesion complex and are indispensable for tight cell-cell adhesion. Dysfunction of this adhesion complex causes dissociation of cancer cells from primary tumor nodules, thus possibly contributing to cancer invasion and metastasis (1). At least three proteins (alpha, beta, and gamma catenin) comprise the cytoplasmic domain of the cadherin cell-cell adhesion complex. Data, with the reported structure of other catenin genes, suggest that vinculin and alpha-catenin generate a superfamily of proteins mediating membrane-cytoskeletal associations (2). Presenilin-1 (PS1) overexpression in human kidney cells enhances cell-cell adhesion and data show that PS1 incorporates into the cadherin/catenin adhesion system and regulates cell-cell adhesion. PS1 concentrates at intercellular contacts in epithelial tissue; in brain, it forms complexes with both E- and N-cadherin and concentrates at synaptic adhesions (3).

Alternate Names

Alpha E-catenin, alpha-catenin, alpha-E-catenin, alphaE-catenin, Cadherin-associated protein, CAP102, catenin (cadherin-associated protein), alpha 1 (102kD), catenin (cadherin-associated protein), alpha 1, 102kDa, catenin alpha-1, FLJ36832, FLJ52416, Renal carcinoma antigen NY-REN-13

Gene Symbol

CTNNA1

UniProt

Additional Catenin alpha 1 Products

Product Documents for Catenin alpha 1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Catenin alpha 1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Catenin alpha 1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Catenin alpha 1 Antibody - BSA Free and earn rewards!

Have you used Catenin alpha 1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...