CBS Antibody (1R2E9)

Novus Biologicals | Catalog # NBP3-15413

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 1R2E9 expressed in HEK293
View all CBS Primary Antibodies »

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 400-551 of human CBS (P35520). EDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CBS Antibody (1R2E9)

Western Blot: CBS Antibody (1R2E9) [NBP3-15413]

Western Blot: CBS Antibody (1R2E9) [NBP3-15413]

Western Blot: CBS Antibody (1R2E9) [NBP3-15413] - Western blot analysis of extracts of various cell lines, using CBS Rabbit mAb (NBP3-15413) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunocytochemistry/ Immunofluorescence: CBS Antibody (1R2E9) [NBP3-15413]

Immunocytochemistry/ Immunofluorescence: CBS Antibody (1R2E9) [NBP3-15413]

Immunocytochemistry/Immunofluorescence: CBS Antibody (1R2E9) [NBP3-15413] - Immunofluorescence analysis of HeLa cells using CBS Rabbit mAb (NBP3-15413) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413]

Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413]

Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413] - Immunohistochemistry of paraffin-embedded human thyroid cancer using CBS Rabbit mAb (NBP3-15413) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Western Blot: CBS Antibody (1R2E9) [NBP3-15413]

Western Blot: CBS Antibody (1R2E9) [NBP3-15413]

Western Blot: CBS Antibody (1R2E9) [NBP3-15413] - Western blot analysis of extracts of various cell lines, using CBS Rabbit mAb (NBP3-15413) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.
Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413]

Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413]

Immunohistochemistry-Paraffin: CBS Antibody (1R2E9) [NBP3-15413] - Immunohistochemistry of paraffin-embedded rat lung using CBS Rabbit mAb (NBP3-15413) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
CBS Antibody (1R2E9)

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] -

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human breast cancer tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
CBS Antibody (1R2E9)

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] -

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
CBS Antibody (1R2E9)

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] -

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human kidney tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.
CBS Antibody (1R2E9)

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] -

Immunohistochemistry: CBS Antibody (1R2E9) [CBS] - Immunohistochemistry analysis of paraffin-embedded Human liver tissue using CBS Rabbit mAb at a dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Applications for CBS Antibody (1R2E9)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:2000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CBS

CBS is encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Alternate Names

cystathionine-beta-synthase, EC 4.2.1.2210Beta-thionase

Gene Symbol

CBS

Additional CBS Products

Product Documents for CBS Antibody (1R2E9)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CBS Antibody (1R2E9)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CBS Antibody (1R2E9)

Customer Reviews for CBS Antibody (1R2E9)

There are currently no reviews for this product. Be the first to review CBS Antibody (1R2E9) and earn rewards!

Have you used CBS Antibody (1R2E9)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies