CBX4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-83225

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Validated:

Human

Cited:

Human

Applications

Validated:

Immunohistochemistry, Immunohistochemistry-Paraffin

Cited:

Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CBX4 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: QPEVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (85%).

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CBX4 Antibody - BSA Free

Immunohistochemistry-Paraffin: CBX4 Antibody [NBP1-83225]

Immunohistochemistry-Paraffin: CBX4 Antibody [NBP1-83225]

Immunohistochemistry-Paraffin: CBX4 Antibody [NBP1-83225] - Staining of human bone marrow shows strong nuclear positivity in subset of hematopoietic cells.

Applications for CBX4 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:50 - 1:200

Immunohistochemistry-Paraffin

1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CBX4

PC2 is the human homolog of the Drosophila 'Polycomb' (Pc) protein which has been identified as a gene family member associated with a cellular memory system that is responsible for the inheritance of gene activity by progeny cells. The human Pc homolog gene is more closely related to a Xenopus Pc homolog, XPc, than to a previously described human Pc homolog, CBX2 (hPc1). However, the hPc2 and CBX2/hPc1 proteins are shown to colocalize in interphase nuclei of human U-2 OS osteosarcoma cells, suggesting that the proteins are part of a common protein complex. The human protein is believed to function as a repressor of proto-oncogene activity and that interference with hPc2 function can lead to derepression of proto-oncogene transcription and subsequently to cellular transformation. Other reports describe PC2 as a protein that has SUMO E3 activity for the corepressors CtBP and CtBP2.

Alternate Names

chromobox homolog 4, chromobox homolog 4 (Drosophila Pc class), Chromobox protein homolog 4, Drosophila), E3 SUMO-protein ligase CBX4, hPC2, NS5ATP1-binding protein 16, Pc class 2 homolog, Pc2, Polycomb 2 homolog

Gene Symbol

CBX4

Additional CBX4 Products

Product Documents for CBX4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CBX4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Citations for CBX4 Antibody - BSA Free

Customer Reviews for CBX4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CBX4 Antibody - BSA Free and earn rewards!

Have you used CBX4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CBX4 Antibody - BSA Free

Showing  1 - 2 的 2 FAQs Showing All

  • Q: I learn from your company web that you are providing atf6, xbp1, cbx4 antibodies against human for immunofluorescence. And from the provided pictures, it seems very good. But I am wondering if anyone use them for immunofluorescence in human cells in your memory or in published papers? And how about them? By the way, you are providing free sample size for the atf6, xbp1 antibodies, aren't you? Could you send me some for tests? One more question, do they work on endogenous proteins but not only on overexpressed proteins?

    A: These products have been validated for use in IF on human: catalog numbers NBP1-40256, NB100-80861, and NBP1-83225. Yes these antibodies should work on the native protein/endogenous protein.

  • Q: We tested WB with NBP1-83225. The MW of this item was around 80kDa in the website. But we saw the result of 60kDa. When she searched paper and the other brand's datasheet, MW of CBX4 was 60kDa. We want to know the reason the difference from yours. Could you explain about it?

    A: The predicted molecular weight of Human CBX4 protein is 61.6kDa. There are a number of reasons why predicted protein size does not always look that way on a Western blot. One has to consider post-translational modifications, splice variants, tissue specific processing, multimer formation and amino acid charge. To confirm specificity, a control such as recombinant protein or overexpression lysate, a downregulated knockdown/knockout lysate, a peptide competition of the primary antibody, or a treatment known to effect the expression of the protein should be used.

  • Q: I learn from your company web that you are providing atf6, xbp1, cbx4 antibodies against human for immunofluorescence. And from the provided pictures, it seems very good. But I am wondering if anyone use them for immunofluorescence in human cells in your memory or in published papers? And how about them? By the way, you are providing free sample size for the atf6, xbp1 antibodies, aren't you? Could you send me some for tests? One more question, do they work on endogenous proteins but not only on overexpressed proteins?

    A: These products have been validated for use in IF on human: catalog numbers NBP1-40256, NB100-80861, and NBP1-83225. Yes these antibodies should work on the native protein/endogenous protein.

  • Q: We tested WB with NBP1-83225. The MW of this item was around 80kDa in the website. But we saw the result of 60kDa. When she searched paper and the other brand's datasheet, MW of CBX4 was 60kDa. We want to know the reason the difference from yours. Could you explain about it?

    A: The predicted molecular weight of Human CBX4 protein is 61.6kDa. There are a number of reasons why predicted protein size does not always look that way on a Western blot. One has to consider post-translational modifications, splice variants, tissue specific processing, multimer formation and amino acid charge. To confirm specificity, a control such as recombinant protein or overexpression lysate, a downregulated knockdown/knockout lysate, a peptide competition of the primary antibody, or a treatment known to effect the expression of the protein should be used.

Showing  1 - 2 的 2 FAQs Showing All
View all FAQs for Antibodies