CD23/Fc epsilon RII Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-16985

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: LKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGT

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD23/Fc epsilon RII Antibody - BSA Free

Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985]

Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985]

Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985] - Analysis in human lymph node and endometrium tissues using Anti-FCER2 antibody. Corresponding FCER2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985]

Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985]

Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985]

Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985]

Immunohistochemistry-Paraffin: CD23/Fc epsilon RII Antibody [NBP3-16985] - Staining of human lymph node shows high expression.

Applications for CD23/Fc epsilon RII Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:1000 - 1:2500

Immunohistochemistry-Paraffin

1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD23/Fc epsilon RII

The CD23 antigen is the low affinity IgE Fc receptor, which is a 49 kDa protein with 38 and 28 kDa fragments. It is expressed on most mature, conventional B cells (but not on peritoneal CD5+ B cells), and can also be found on the surface of T cells, macrophages, platelets and EBV transformed B lymphoblasts. Expression of CD23 has been detected in neoplastic cells from cases of B cell chronic Lymphocytic leukemia. CD23 is expressed by B cells in the follicular mantle but not by proliferating germinal centre cells. CD23 is also expressed by eosinophils. CD23 is distinct from the high affinity IgE receptors found on basophils and mast cells, which mediate allergic reactions. The low affinity receptors are thought to play a role in isotype specific immunoregulation. The regulation of CD23 surface expression appears to be integral with the complex IgE system, which involves interactions of cells, cytokines, antibodies and regulatory factors. CD23 has been described as a

Long Name

Fc epsilon Receptor II

Alternate Names

CD23, CLEC4J, Fc epsilon RII, FCER2, Fcer2a, FceRII, IGEBF, Ly-42

Gene Symbol

FCER2

Additional CD23/Fc epsilon RII Products

Product Documents for CD23/Fc epsilon RII Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD23/Fc epsilon RII Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD23/Fc epsilon RII Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD23/Fc epsilon RII Antibody - BSA Free and earn rewards!

Have you used CD23/Fc epsilon RII Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...