CD300a/LMIR1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-84431

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: SGDHSELSQNPKQASPREELHYASVVFDSNTNRIAAQRPREEEPDSDYSVIRK

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CD300a/LMIR1 Antibody - BSA Free

CD300a/LMIR1 Antibody - BSA Free Immunohistochemistry-Paraffin: CD300a/LMIR1 Antibody - BSA Free [NBP1-84431]

Immunohistochemistry-Paraffin: CD300a/LMIR1 Antibody - BSA Free [NBP1-84431]

Staining of human testis shows moderate cytoplasmic/membranous positivity in cells in seminiferous ducts and leydig cells.
CD300a/LMIR1 Antibody - BSA Free Immunohistochemistry-Paraffin: CD300a/LMIR1 Antibody - BSA Free [NBP1-84431]

Immunohistochemistry-Paraffin: CD300a/LMIR1 Antibody - BSA Free [NBP1-84431]

Staining of human placenta shows strong cytoplasmic/membranous positivity in decidual cells, hoffbauer cells and trophoblastic cells.
CD300a/LMIR1 Antibody - BSA Free Immunohistochemistry-Paraffin: CD300a/LMIR1 Antibody - BSA Free [NBP1-84431]

Immunohistochemistry-Paraffin: CD300a/LMIR1 Antibody - BSA Free [NBP1-84431]

Staining of human lymphoid node shows strong cytoplasmic/membranous positivity in non-germinal center cells.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD300a/LMIR1

Human CD300a, otherwise known as IRp60 (inhibitory receptor protein 60), is a 60kDa transmembrane glycoprotein expressed by natural killer cells (NK), T and B cell subsets, monocytes, neutrophils, macrophages, granulocytes, dendritic cells (DC) and mast cells. Studies have shown that the cross-linking of CD300a on NK results in a down-regulation of their cytolytic activity, whilst cross-linking of CD300a on mast cells, inhibits IgE-induced degranulation and SCF-mediated survival. Furthermore, cross-linking of CD300a on the surface of eosinophils has been shown to significantly inhibit their survival, chemotaxis and activation in response to certain inflammatory cytokines, whilst eosinophil-derived MBP (major basic protein) and EDN (neurotoxin), can down-regulate CD300a expression on mast cells in vitro.

Alternate Names

CD300a, CLM8, CMRF-35H, IGSF12, IRC1, IRC2, IRp60, LMIR1, MAIR-I, Mcipr1, NKRL, Pigr4

Gene Symbol

CD300A

Additional CD300a/LMIR1 Products

Product Documents for CD300a/LMIR1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD300a/LMIR1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD300a/LMIR1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD300a/LMIR1 Antibody - BSA Free and earn rewards!

Have you used CD300a/LMIR1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...