CD40 Ligand/TNFSF5 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-59186

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Synthetic peptides corresponding to CD40LG(CD40 ligand (TNF superfamily, member 5, hyper-IgM syndrome)) The peptide sequence was selected from the middle region of CD40LG. Peptide sequence ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN The peptide sequence for this immunogen was taken from within the described region.

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Description

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Scientific Data Images for CD40 Ligand/TNFSF5 Antibody - BSA Free

Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186]

Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186]

Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186] - Sample Type: Human Fetal Muscle Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide Primary Antibody Concentration: 1 ug/ml Peptide Concentration: 5 ug/ml Lysate Quantity: 25 ug/lane/lane Gel Concentration: 0.12
Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP1-59186]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP1-59186]

Immunohistochemistry-Paraffin: CD40 Ligand/TNFSF5 Antibody [NBP1-59186] - Human thymus tissue at an antibody concentration of 5ug/ml.
Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186]

Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186]

Western Blot: CD40 Ligand/TNFSF5 Antibody [NBP1-59186] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.

Applications for CD40 Ligand/TNFSF5 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:10-1:500

Immunohistochemistry-Paraffin

1:10-1:500

Western Blot

1.0 ug/ml

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS, 2% Sucrose

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

0.5 mg/ml

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CD40 Ligand/TNFSF5

CD40LG is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome.The protein encoded by this gene is expressed on the surface of T cells. It regulates B cell function by engaging CD40 on the B cell surface. A defect in this gene results in an inability to undergo immunoglobulin class switch and is associated with hyper-IgM syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-1375 BC071754.1 1-1375 1376-1599 X67878.1 1349-1572 1600-1834 BC071754.1 1596-1830

Alternate Names

CD154, CD40L, CD40LG, gp39, TNFSF5, TRAP

Gene Symbol

CD40LG

UniProt

Additional CD40 Ligand/TNFSF5 Products

Product Documents for CD40 Ligand/TNFSF5 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CD40 Ligand/TNFSF5 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CD40 Ligand/TNFSF5 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CD40 Ligand/TNFSF5 Antibody - BSA Free and earn rewards!

Have you used CD40 Ligand/TNFSF5 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CD40 Ligand/TNFSF5 Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: I am looking for paired ABs for use in detecting CD40L (rat) by ELISA. Do you have such a reagent(s) available?

    A:

    Unfortunately we currently do not have any CD40 Ligand antibody pairs that have been validated in Rat. The only antibody pairs we offer for CD40L are validated in Human. I apologize for this inconvenience. If you would be interested in testing one of our products in Rat I'd like to invite you to participate in our Innovators Reward Program. Please contact us at innovators@novusbio.com with any questions regarding this program.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies