CDS1 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-85894

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (91%), Rat (91%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CDS1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human fallopian tube shows moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human cerebellum shows moderate cytoplasmic positivity in purkinje cells.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human duodenum shows moderate positivity in glandular cells.
Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894]

Immunohistochemistry-Paraffin: CDS1 Antibody [NBP1-85894] - Staining of human endometrium shows weak cytoplasmic positivity in glandular cells.
CDS1 Antibody - BSA Free Immunocytochemistry/ Immunofluorescence: CDS1 Antibody [NBP1-85894]

Immunocytochemistry/ Immunofluorescence: CDS1 Antibody [NBP1-85894]

Staining of human cell line A-431 shows localization to nucleus & nuclear membrane.

Applications for CDS1 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CDS1

Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13. [provided by RefSeq]

Alternate Names

CDP-DAG synthase 1, CDP-DG synthase 1, CDP-DG synthetase 1, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1, CDP-diacylglycerol synthase 1, CDP-diglyceride pyrophosphorylase 1, CDP-diglyceride synthase 1, CDP-diglyceride synthetase 1, CDS, CDS 1, CTP:phosphatidate cytidylyltransferase 1, EC 2.7.7.41, phosphatidate cytidylyltransferase 1

Gene Symbol

CDS1

Additional CDS1 Products

Product Documents for CDS1 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CDS1 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CDS1 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CDS1 Antibody - BSA Free and earn rewards!

Have you used CDS1 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...