CELSR2 Antibody - BSA Free
Novus Biologicals | Catalog # NLS1943
![Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]](https://resources.rndsystems.com/images/products/CELSR2-Antibody-Immunohistochemistry-Paraffin-NLS1943-img0004.jpg "Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]")
Scientific images may be resized, cropped, or adjusted for brightness or contrast for presentation purposes. These updates are limited to presentation and do not affect the underlying scientific interpretation of the data. Where available, additional source data may be provided upon request.
Key Product Details
Species Reactivity
Validated:
Cited:
Predicted:
Applications
Validated:
Cited:
Label
Antibody Source
Format
Product Specifications
Immunogen
Epitope
Reactivity Notes
Localization
Specificity
Clonality
Host
Isotype
Description
Scientific Data Images for CELSR2 Antibody - BSA Free
Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]
Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Anti-CELSR2 antibody IHC of human Breast, Carcinoma. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval.![Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]](https://resources.rndsystems.com/images/products/CELSR2-Antibody-Immunohistochemistry-Paraffin-NLS1943-img0001.jpg "Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]")
Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]
Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Analysis of anti-CELSR2 antibody with human, colon, epithelium.![Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]](https://resources.rndsystems.com/images/products/CELSR2-Antibody-Immunohistochemistry-Paraffin-NLS1943-img0003.jpg "Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]")
Immunohistochemistry-Paraffin: CELSR2 Antibody - BSA Free [NLS1943]
Immunohistochemistry-Paraffin: CELSR2 Antibody [NLS1943] - Analysis of anti-CELSR2 antibody with human brain, cortex, neurons at dilution 7 ug/ml.Applications for CELSR2 Antibody - BSA Free
Immunohistochemistry-Paraffin
Formulation, Preparation, and Storage
Purification
Formulation
Format
Preservative
Concentration
Shipping
Stability & Storage
Background: CELSR2
Long Name
Alternate Names
Gene Symbol
UniProt
Additional CELSR2 Products
Product Documents for CELSR2 Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CELSR2 Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Related Research Areas
Citations for CELSR2 Antibody - BSA Free
Powered by Bioz
Customer Reviews for CELSR2 Antibody - BSA Free
There are currently no reviews for this product. Be the first to review CELSR2 Antibody - BSA Free and earn rewards!
Have you used CELSR2 Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 for a review with an image
$10/€7/£6/$10CAN/¥1110 for a review without an image
Submit a review
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
FAQs for CELSR2 Antibody - BSA Free
-
Q: Can I please know the immunogenic sequences on this antibody ? I know its on the N-Terminal but I need to know the exact immunogenic sequences please. Further more, I am looking for the blocking peptide of this antibody, do you have any? Thank you
A: H00001952-Q01 is actually a partial recombinant protein whose sequence is as follows: SPQGKLTLPEEHPCLKAPRLRCQSCKLAQAPGLRAGERSPEESLGGRRKRNVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSNQFFS. We do have three antibodies for this target, catalog numbers NLS1942, NLS1943 and NBP1-85712, which can be viewed on our website. The immunizing sequences for these antibodies are proprietary and cannot be disclosed. If there is a specific region that you are interested in, I would be happy to see whether these antibodies will target that area or not.