Ceruloplasmin Antibody - BSA Free

Novus Biologicals | Catalog # NBP3-03563

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

Recombinant fusion protein containing a sequence corresponding to amino acids 680-790 of human Ceruloplasmin (NP_000087.1). QTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRRQSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYKKVVYRQYTDS

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Theoretical MW

122 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Scientific Data Images for Ceruloplasmin Antibody - BSA Free

Ceruloplasmin Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Ceruloplasmin Antibody - Azide and BSA Free [Ceruloplasmin] -

Immunocytochemistry/ Immunofluorescence: Ceruloplasmin Antibody - Azide and BSA Free [Ceruloplasmin] - Immunofluorescence analysis of paraffin-embedded Human liver cancer using Ceruloplasmin Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ceruloplasmin Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Ceruloplasmin Antibody - Azide and BSA Free [Ceruloplasmin] -

Immunocytochemistry/ Immunofluorescence: Ceruloplasmin Antibody - Azide and BSA Free [Ceruloplasmin] - Immunofluorescence analysis of paraffin-embedded Mouse liver using Ceruloplasmin Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.
Ceruloplasmin Antibody - Azide and BSA Free

Immunocytochemistry/ Immunofluorescence: Ceruloplasmin Antibody - Azide and BSA Free [Ceruloplasmin] -

Immunocytochemistry/ Immunofluorescence: Ceruloplasmin Antibody - Azide and BSA Free [Ceruloplasmin] - Immunofluorescence analysis of paraffin-embedded Rat liver using Ceruloplasmin Rabbit pAb at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Applications for Ceruloplasmin Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50-1:200

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol

Format

BSA Free

Preservative

0.09% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Ceruloplasmin

The protein encoded by the Ceruloplasmin gene is a metalloprotein that binds most of the copper in plasma and is involved in theperoxidation of Fe(II)transferrin to Fe(III) transferrin. Mutations in this gene cause aceruloplasminemia, whichresults in iron accumulation and tissue damage, and is associated with diabetes and neurologic abnormalities.(provided by RefSeq)

Alternate Names

ceruloplasmin, ceruloplasmin (ferroxidase), CP-2, EC 1.16.3.1, Ferroxidase

Gene Symbol

CP

Additional Ceruloplasmin Products

Product Documents for Ceruloplasmin Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Ceruloplasmin Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Customer Reviews for Ceruloplasmin Antibody - BSA Free

There are currently no reviews for this product. Be the first to review Ceruloplasmin Antibody - BSA Free and earn rewards!

Have you used Ceruloplasmin Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ceruloplasmin Antibody - BSA Free

Showing  1 - 11 FAQ Showing All
  • Q: We want to set up a Ceruloplasmin enzyme immunoassay. Could you suggest a suitable/optimal antibody pair for a sandwich format?

    A: Currently we do not carry any validated antibody pairs for sandwich ELISA to detect ceruloplasmin, however we do have ELISA kits that have been optimized and validated for human and rat.

Showing  1 - 11 FAQ Showing All
View all FAQs for Antibodies
Loading...