CHD3 Antibody (8Z6L6)

Novus Biologicals | Catalog # NBP3-16632

Recombinant Monoclonal Antibody
Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 8Z6L6 expressed in HEK293
View all CHD3 Primary Antibodies »

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CHD3 (Q12873). MKAADTVILWARSKNDQLRISFPPGLCWGDRMPDKDDIRLLPSALGVKKRKRGPKKQKENKPGKPRKRKKRDSEEEFGSERDEYREKSESGGSEYGTGPG

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CHD3 Antibody (8Z6L6)

Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632]

Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632]

Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of Mouse brain, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.
Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632]

Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632]

Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of various cell lines, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632]

Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632]

Western Blot: CHD3 Antibody (8Z6L6) [NBP3-16632] - Western blot analysis of extracts of Rat brain, using CHD3 Rabbit mAb (NBP3-16632) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit. Exposure time: 3min.
CHD3 Antibody (8Z6L6)

Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] -

Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] - Confocal imaging of paraffin-embedded Human kidney using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
CHD3 Antibody (8Z6L6)

Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] -

Immunocytochemistry/ Immunofluorescence: CHD3 Antibody (8Z6L6) [NBP3-16632] - Confocal imaging of paraffin-embedded Mouse brain using CHD3 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).DAPI was used for nuclear staining (Blue). Objective: 40x. Perform microwave antigen retrieval with 0.01 M citRate buffer (pH 6.0) prior to IF staining.
CHD3 Antibody (8Z6L6)

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] -

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded rat spleen tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CHD3 Antibody (8Z6L6)

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] -

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human tonsil tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CHD3 Antibody (8Z6L6)

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] -

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded human cervix cancer tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CHD3 Antibody (8Z6L6)

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] -

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse brain tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
CHD3 Antibody (8Z6L6)

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] -

Immunohistochemistry: CHD3 Antibody (8Z6L6) [NBP3-16632] - Immunohistochemistry analysis of CHD3 in paraffin-embedded mouse kidney tissue using CHD3 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Applications for CHD3 Antibody (8Z6L6)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:500 - 1:1000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: CHD3

CHD3 is a member of the CHD (chromodomain-helicase-DNA-binding) family of proteins that interacts with nucleosomes and plays a role in chromatin remodeling to modulate transcription. The members of the CHD family of proteins possess 3 common structural and functional domains: a chromodomain (chromatin organization modifier), an SNF2-like helicase/ATPase domain, and a C-terminal DNA-binding domain. CHD3 is a key component of the NuRD (nucleosomal remodeling) complex and directly interacts with histone deacetylases 1 and 2, ATR, and TRIM 27. Studies in several species suggest a role for CHD3 in the repression of developmental genes.

Alternate Names

ATP-dependent helicase CHD3, CHD-3, chromodomain helicase DNA binding protein 3, chromodomain-helicase-DNA-binding protein 3, EC 3.6.1, EC 3.6.4.12, hZFH, Mi-2 autoantigen 240 kDa protein, Mi-2a, Mi2-alpha, ZFH, Zinc finger helicase, zinc-finger helicase (Snf2-like)

Gene Symbol

CHD3

Additional CHD3 Products

Product Documents for CHD3 Antibody (8Z6L6)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHD3 Antibody (8Z6L6)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHD3 Antibody (8Z6L6)

There are currently no reviews for this product. Be the first to review CHD3 Antibody (8Z6L6) and earn rewards!

Have you used CHD3 Antibody (8Z6L6)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies