CHTF8 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-30490

Novus Biologicals
100% Guarantee

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
View all CHTF8 Primary Antibodies »

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: PIGPNSAHFSRPVGPMGVNANPFPRGAGSSAFSQSSGTLASNPATFQRSAGLQGSNPTIFPRASGPLGPNPANFPRAT

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CHTF8 Antibody - BSA Free

Western Blot: CHTF8 Antibody [NBP2-30490]

Western Blot: CHTF8 Antibody [NBP2-30490]

Western Blot: CHTF8 Antibody [NBP2-30490] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CHTF8 Antibody [NBP2-30490]

Immunohistochemistry-Paraffin: CHTF8 Antibody [NBP2-30490]

Immunohistochemistry-Paraffin: CHTF8 Antibody [NBP2-30490] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.

Applications for CHTF8 Antibody - BSA Free

Application
Recommended Usage

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CHTF8

CHTF8 encodes a short protein that forms part of the Ctf18 replication factor C (RFC) complex that occurs in both yeast and mammals. The heteroheptameric RFC complex plays a role in sister chromatid cohesion and may load the replication clamp PCNA (proliferating cell nuclear antigen) onto DNA during DNA replication and repair. This gene is ubiquitously expressed and has been shown to have reduced expression in renal and prostate tumors. Alternative splicing results in multiple variants encoding different isoforms. This gene has a pseudogene on chromosome X. [provided by RefSeq]. Transcript Variant: This variant (1) represents the longest transcript. Variants 1 and 4 encode the same isoform (A).

Alternate Names

chromosome transmission fidelity protein 8 homolog, CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae), CTF8hCTF8, Decreased expression in renal and prostate cancer protein, DERPCchromosome transmission fidelity factor 8 homolog, FLJ20400

Gene Symbol

CHTF8

UniProt

P0CG13 (Human)

Additional CHTF8 Products

Product Documents for CHTF8 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Download SDS

Product Specific Notices for CHTF8 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CHTF8 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CHTF8 Antibody - BSA Free and earn rewards!

Have you used CHTF8 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies