![Immunocytochemistry/ Immunofluorescence: CHTOP Antibody [NBP1-88085]](https://resources.rndsystems.com/images/products/CHTOP-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88085-img0007.jpg "Immunocytochemistry/ Immunofluorescence: CHTOP Antibody [NBP1-88085]")
Loading...
Key Product Details
Species Reactivity
Validated:
Human, Mouse
Predicted:
Rat (99%). Backed by our 100% Guarantee.
Applications
Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen, Western Blot, Immunocytochemistry/ Immunofluorescence
Label
Unconjugated
Antibody Source
Polyclonal Rabbit IgG
Format
BSA Free
Loading...
Product Specifications
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: GRGRGMIGRGRGGFGGRGRGRGRGRGALARPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND
Reactivity Notes
Mouse reactivity reported from a verified customer review.
Clonality
Polyclonal
Host
Rabbit
Isotype
IgG
Scientific Data Images for CHTOP Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence: CHTOP Antibody [NBP1-88085]
Immunocytochemistry/Immunofluorescence: CHTOP Antibody [NBP1-88085] - Staining of human cell line A-431 shows localization to nuclear speckles & cytoplasmic bodies. Antibody staining is shown in green.![Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085]](https://resources.rndsystems.com/images/products/CHTOP-Antibody-Immunohistochemistry-Frozen-NBP1-88085-img0016.jpg "Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085]")
Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085]
Immunohistochemistry-Frozen: CHTOP Antibody [NBP1-88085] - The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques. Antibody at 1:50. Blocking: 1 hour with 1% BSA before addition of the primary antibody. Secondary antibody: Alexa Fluor Donkey Anti Rabbit 488. HC-Fr image submitted by a verified customer review.![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]](https://resources.rndsystems.com/images/products/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0010.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]")
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human cerrebellum shows strong nuclear positivity in cells in granular layer.![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]](https://resources.rndsystems.com/images/products/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0013.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]")
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]](https://resources.rndsystems.com/images/products/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0014.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]")
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human skeletal muscle shows strong nuclear positivity in myocytes.![Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]](https://resources.rndsystems.com/images/products/CHTOP-Antibody-Immunohistochemistry-Paraffin-NBP1-88085-img0015.jpg "Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]")
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085]
Immunohistochemistry-Paraffin: CHTOP Antibody [NBP1-88085] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.![CHTOP Antibody - BSA Free Western Blot: CHTOP Antibody - BSA Free [NBP1-88085]](https://resources.rndsystems.com/images/products/nbp1-88085_rabbit-polyclonal-chtop-antibody-65202516171611.jpg "Western Blot: CHTOP Antibody - BSA Free [NBP1-88085]")
Western Blot: CHTOP Antibody - BSA Free [NBP1-88085]
Analysis in control (vector only transfected HEK293T lysate) and CHTOP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).Applications for CHTOP Antibody - BSA Free
Application
Recommended Usage
Immunocytochemistry/ Immunofluorescence
0.25 - 2 ug/mL
Immunohistochemistry
1:200 - 1:500
Immunohistochemistry-Paraffin
1:200 - 1:500
Western Blot
0.04 - 0.4 ug/mL
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. This CHTOP Antibody is validated for IHC-Fr from a verified customer review.
Reviewed Applications
Read 1 review rated 5 using NBP1-88085 in the following applications:
Formulation, Preparation, and Storage
Purification
Affinity purified
Formulation
PBS (pH 7.2) and 40% Glycerol
Format
BSA Free
Preservative
0.02% Sodium Azide
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Shipping
The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.
Stability & Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Background: CHTOP
Alternate Names
C1orf77, chromatin target of PRMT1, DKFZp547E1010, FOPMGC86949, Friend of PRMT1 protein, MGC131924, pp7704, RP1-178F15.2, Small arginine- and glycine-rich protein, small protein rich in arginine and glycine, SRAGchromosome 1 open reading frame 77
Gene Symbol
CHTOP
Additional CHTOP Products
Product Documents for CHTOP Antibody - BSA Free
Certificate of Analysis
To download a Certificate of Analysis, please enter a lot or batch number in the search box below.
Product Specific Notices for CHTOP Antibody - BSA Free
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Customer Reviews for CHTOP Antibody - BSA Free (1)
5 out of 5
1 Customer Rating
Have you used CHTOP Antibody - BSA Free?
Submit a review and receive an Amazon gift card!
$25/€18/£15/$25CAN/¥2500 Yen for a review with an image
$10/€7/£6/$10CAN/¥1110 Yen for a review without an image
Submit a review
Customer Images
Showing
1
-
1 的
1 review
Showing All
Filter By:
-
Application: Immunohistochemistry-FrozenSample Tested: E11.5 mouse embryo fixed in 4% PFASpecies: MouseVerified Customer | Posted 02/12/2021Chtop expression in a transverse section of an E11.5 mouse embryoDilution used - 1:50. The staining was done on an E11.5 mouse transverse section (fixed on 4% PFA overnight) and done using standard IF techniques. Blocking - 1 hour with 1% BSA before addition of the primary antibody Secondary antibody - Alexa Fluor Donkey Anti Rabbit 488
Bio-Techne ResponseThis review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.
There are no reviews that match your criteria.
Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
- Antigen Retrieval Protocol (PIER)
- Antigen Retrieval for Frozen Sections Protocol
- Appropriate Fixation of IHC/ICC Samples
- Cellular Response to Hypoxia Protocols
- Chromogenic IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Chromogenic Immunohistochemistry Staining of Frozen Tissue
- ClariTSA™ Fluorophore Kits
- Detection & Visualization of Antibody Binding
- Fluorescent IHC Staining of Frozen Tissue Protocol
- Graphic Protocol for Heat-induced Epitope Retrieval
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Graphic Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Graphic Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- ICC Cell Smear Protocol for Suspension Cells
- ICC Immunocytochemistry Protocol Videos
- ICC for Adherent Cells
- IHC Sample Preparation (Frozen sections vs Paraffin)
- Immunocytochemistry (ICC) Protocol
- Immunocytochemistry Troubleshooting
- Immunofluorescence of Organoids Embedded in Cultrex Basement Membrane Extract
- Immunofluorescent IHC Staining of Formalin-Fixed Paraffin-Embedded (FFPE) Tissue Protocol
- Immunohistochemistry (IHC) and Immunocytochemistry (ICC) Protocols
- Immunohistochemistry Frozen Troubleshooting
- Immunohistochemistry Paraffin Troubleshooting
- Preparing Samples for IHC/ICC Experiments
- Preventing Non-Specific Staining (Non-Specific Binding)
- Primary Antibody Selection & Optimization
- Protocol for Heat-Induced Epitope Retrieval (HIER)
- Protocol for Making a 4% Formaldehyde Solution in PBS
- Protocol for VisUCyte™ HRP Polymer Detection Reagent
- Protocol for the Fluorescent ICC Staining of Cell Smears - Graphic
- Protocol for the Fluorescent ICC Staining of Cultured Cells on Coverslips - Graphic
- Protocol for the Preparation & Fixation of Cells on Coverslips
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Frozen Tissue Sections - Graphic
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation and Chromogenic IHC Staining of Paraffin-embedded Tissue Sections - Graphic
- Protocol for the Preparation and Fluorescent ICC Staining of Cells on Coverslips
- Protocol for the Preparation and Fluorescent ICC Staining of Non-adherent Cells
- Protocol for the Preparation and Fluorescent ICC Staining of Stem Cells on Coverslips
- Protocol for the Preparation and Fluorescent IHC Staining of Frozen Tissue Sections
- Protocol for the Preparation and Fluorescent IHC Staining of Paraffin-embedded Tissue Sections
- Protocol for the Preparation of Gelatin-coated Slides for Histological Tissue Sections
- Protocol for the Preparation of a Cell Smear for Non-adherent Cell ICC - Graphic
- R&D Systems Quality Control Western Blot Protocol
- TUNEL and Active Caspase-3 Detection by IHC/ICC Protocol
- The Importance of IHC/ICC Controls
- Troubleshooting Guide: Immunohistochemistry
- Troubleshooting Guide: Western Blot Figures
- Western Blot Conditions
- Western Blot Protocol
- Western Blot Protocol for Cell Lysates
- Western Blot Troubleshooting
- Western Blot Troubleshooting Guide
- View all Protocols, Troubleshooting, Illustrated assays and Webinars
Loading...