Chymotrypsin-like protease Antibody (10Z4K3)

Novus Biologicals | Catalog # NBP3-15845

Recombinant Monoclonal Antibody
Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human, Mouse, Rat

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Recombinant Monoclonal Rabbit IgG Clone # 10Z4K3 expressed in HEK293
Loading...

Product Specifications

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 165-264 of human Chymotrypsin-like protease (P40313). GVGNVTPAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASSCQGDSGGPLVCQKGNTWVLIGIVSWGTKNCNVRAPAVYTRVSKFSTWINQVIAYN

Clonality

Monoclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Chymotrypsin-like protease Antibody (10Z4K3)

Western Blot: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845]

Western Blot: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845]

Western Blot: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845] - Western blot analysis of extracts of various cell lines, using Chymotrypsin-like protease Rabbit mAb (NBP3-15845) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845] - Immunohistochemistry of paraffin-embedded mouse pancreas using Chymotrypsin-like protease Rabbit mAb (NBP3-15845) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845]

Immunohistochemistry-Paraffin: Chymotrypsin-like protease Antibody (10Z4K3) [NBP3-15845] - Immunohistochemistry of paraffin-embedded rat pancreas using Chymotrypsin-like protease Rabbit mAb (NBP3-15845) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Chymotrypsin-like protease Antibody (10Z4K3)

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] -

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] - Confocal imaging of paraffin-embedded Mouse pancreas tissue using Chymotrypsin-like protease Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Chymotrypsin-like protease Antibody (10Z4K3)

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] -

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] - Confocal imaging of paraffin-embedded Rat pancreas tissue using Chymotrypsin-like protease Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Chymotrypsin-like protease Antibody (10Z4K3)

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] -

Immunocytochemistry/ Immunofluorescence: Chymotrypsin-like protease Antibody (10Z4K3) [Chymotrypsin-like protease] - Confocal imaging of paraffin-embedded Human pancreas tissue using Chymotrypsin-like protease Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L). DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Applications for Chymotrypsin-like protease Antibody (10Z4K3)

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

1:50 - 1:200

Immunohistochemistry

1:50 - 1:200

Western Blot

1:5000 - 1:8000

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.3), 50% glycerol, 0.05% BSA

Preservative

0.02% Sodium Azide

Concentration

Please see the vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at -20C. Avoid freeze-thaw cycles.

Background: Chymotrypsin-like protease

CTRL - chymotrypsin-like

Alternate Names

chymotrypsin-like, chymotrypsin-like protease CTRL-1, CTRL1, EC 3.4.21, EC 3.4.21.-, MGC70821

Gene Symbol

CTRL

Additional Chymotrypsin-like protease Products

Product Documents for Chymotrypsin-like protease Antibody (10Z4K3)

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Chymotrypsin-like protease Antibody (10Z4K3)

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Chymotrypsin-like protease Antibody (10Z4K3)

There are currently no reviews for this product. Be the first to review Chymotrypsin-like protease Antibody (10Z4K3) and earn rewards!

Have you used Chymotrypsin-like protease Antibody (10Z4K3)?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...