Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free

Novus Biologicals | Catalog # NBP2-49293

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Validated:

Human

Predicted:

Mouse (100%), Rat (100%). Backed by our 100% Guarantee.

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against a recombinant protein corresponding to amino acids: ESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQ

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunocytochemistry/ Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human cell line U-251 MG shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human skeletal muscle shows low positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuropil.
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human placenta shows strong membranous positivity in trophoblstic cells.
Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293]

Immunohistochemistry-Paraffin: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - Staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells.
Clathrin Heavy Chain 1/CHC17 Antibody

Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] -

Immunocytochemistry/Immunofluorescence: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] - SHSY5Y cells differentiated into neurons. Green: CLTC antibody diluted 1:100 in PBS-Triton 0.2%X-100/BSA 1%. 2 hours at RT. Blue: DAPI. Image from verified customer review
Clathrin Heavy Chain 1/CHC17 Antibody

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] -

Western Blot: Clathrin Heavy Chain 1/CHC17 Antibody [NBP2-49293] -Analysis in human cell line U-87 MG.

Applications for Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:500 - 1:1000

Immunohistochemistry-Paraffin

1:500 - 1:1000

Western Blot

0.04 - 0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

Reviewed Applications

Read 1 review rated 4 using NBP2-49293 in the following applications:

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: Clathrin Heavy Chain 1/CHC17

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains (192 kDa) and three light chains (LCa or LCb, 25-29 kDa) and self assembles into a polyhedral cytoskeletal element. Self assembly facilitates clathrin's central role in membrane sorting and selective transport within the cell.

Long Name

Clathrin Heavy Chain on Chromosome 17

Alternate Names

CHC17, CLH17, CLTC, CLTCL2

Gene Symbol

CLTC

Additional Clathrin Heavy Chain 1/CHC17 Products

Product Documents for Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free (1)

4 out of 5
1 Customer Rating
5 Stars
0%
4 Stars
100%
3 Stars
0%
2 Stars
0%
1 Stars
0%

Have you used Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 Yen for a review with an image

$10/€7/£6/$10CAN/¥1110 Yen for a review without an image

Submit a review
Amazon Gift Card

Customer Images


Showing  1 - 11 review Showing All
Filter By:
  • Clathrin Heavy Chain 1/CHC17 Antibody
    Name: Patricia Carulla Martí
    Application: Immunocytochemistry
    Sample Tested: Neuroblastoma cells SH-SY5Y differentiated into neurons
    Species: Human
    Verified Customer | Posted 05/25/2023
    SHSY5Y cells differentiated into neurons Green: CLTC antibody diluted 1:100 in PBS-Triton 0.2%X-100/BSA 1%. 2 hours at RT. Blue: DAPI
    Clathrin Heavy Chain 1/CHC17 Antibody - BSA Free NBP2-49293

There are no reviews that match your criteria.

Showing  1 - 11 review Showing All

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...

Associated Pathways

Notch Signaling Pathways
Notch Signaling Pathway Thumbnail