CLIP4 Antibody - BSA Free

Novus Biologicals | Catalog # NBP1-91793

Novus Biologicals
Loading...

Key Product Details

Species Reactivity

Human

Applications

Immunohistochemistry, Immunohistochemistry-Paraffin, Western Blot, Immunocytochemistry/ Immunofluorescence

Label

Unconjugated

Antibody Source

Polyclonal Rabbit IgG

Format

BSA Free
Loading...

Product Specifications

Immunogen

This antibody was developed against Recombinant Protein corresponding to amino acids: TIEDLPDFPLEGNPLFGRYPFIFSASDTPVIFSISAAPMPSDCEFSFFDPNDASCQEIL

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (86%), Rat (86%)

Clonality

Polyclonal

Host

Rabbit

Isotype

IgG

Scientific Data Images for CLIP4 Antibody - BSA Free

Western Blot: CLIP4 Antibody [NBP1-91793]

Western Blot: CLIP4 Antibody [NBP1-91793]

Western Blot: CLIP4 Antibody [NBP1-91793] - Analysis in human cell line A-431.
Immunocytochemistry/ Immunofluorescence: CLIP4 Antibody [NBP1-91793]

Immunocytochemistry/ Immunofluorescence: CLIP4 Antibody [NBP1-91793]

Immunocytochemistry/Immunofluorescence: CLIP4 Antibody [NBP1-91793] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: CLIP4 Antibody [NBP1-91793]

Immunohistochemistry-Paraffin: CLIP4 Antibody [NBP1-91793]

Immunohistochemistry-Paraffin: CLIP4 Antibody [NBP1-91793] - Staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
CLIP4 Antibody - BSA Free Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Staining of human liver shows no positivity in hepatocytes as expected.
CLIP4 Antibody - BSA Free Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.
CLIP4 Antibody - BSA Free Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Staining of human heart muscle shows weak cytoplasmic positivity in cardiomyocytes.
CLIP4 Antibody - BSA Free Western Blot: CLIP4 Antibody - BSA Free [NBP1-91793]

Western Blot: CLIP4 Antibody - BSA Free [NBP1-91793]

Analysis in human cell line A-431.
CLIP4 Antibody - BSA Free Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Immunohistochemistry: CLIP4 Antibody - BSA Free [NBP1-91793]

Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Applications for CLIP4 Antibody - BSA Free

Application
Recommended Usage

Immunocytochemistry/ Immunofluorescence

0.25-2 ug/ml

Immunohistochemistry

1:20 - 1:50

Immunohistochemistry-Paraffin

1:20 - 1:50

Western Blot

0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Formulation, Preparation, and Storage

Purification

Affinity purified

Formulation

PBS (pH 7.2) and 40% Glycerol

Format

BSA Free

Preservative

0.02% Sodium Azide

Concentration

Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Shipping

The product is shipped with polar packs. Upon receipt, store it immediately at the temperature recommended below.

Stability & Storage

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Background: CLIP4

Alternate Names

CAP-GLY domain containing linker protein family, member 4, CAP-Gly domain-containing linker protein 4, FLJ21069, FLJ32705, restin-like 2, Restin-like protein 2, RSNL2

Gene Symbol

CLIP4

Additional CLIP4 Products

Product Documents for CLIP4 Antibody - BSA Free

Certificate of Analysis

To download a Certificate of Analysis, please enter a lot or batch number in the search box below.

Product Specific Notices for CLIP4 Antibody - BSA Free

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customer Reviews for CLIP4 Antibody - BSA Free

There are currently no reviews for this product. Be the first to review CLIP4 Antibody - BSA Free and earn rewards!

Have you used CLIP4 Antibody - BSA Free?

Submit a review and receive an Amazon gift card!

$25/€18/£15/$25CAN/¥2500 for a review with an image

$10/€7/£6/$10CAN/¥1110 for a review without an image

Submit a review
Amazon Gift Card

Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs

No product specific FAQs exist for this product.

View all FAQs for Antibodies
Loading...